ROMO1 (NM_080748) Human Tagged ORF Clone

SKU
RC210655
ROMO1 (Myc-DDK-tagged)-Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ROMO1
Synonyms bA353C18.2; C20orf52; MTGM; MTGMP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210655 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGTGGCCGTGGGTCCCTACGGACAGTCCCAGCCAAGCTGCTTCGACCGTGTCAAAATGGGCTTCG
TGATGGGTTGCGCCGTGGGCATGGCGGCCGGGGCGCTCTTCGGCACCTTTTCCTGTCTCAGGATCGGAAT
GCGGGGTCGAGAGCTGATGGGCGGCATTGGGAAAACCATGATGCAGAGTGGCGGCACCTTTGGCACATTC
ATGGCCATTGGGATGGGCATCCGATGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210655 protein sequence
Red=Cloning site Green=Tags(s)

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF
MAIGMGIRC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_080748
ORF Size 237 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080748.3
RefSeq Size 477 bp
RefSeq ORF 240 bp
Locus ID 140823
UniProt ID P60602
Cytogenetics 20q11.22
Protein Families Transmembrane
MW 8.2 kDa
Summary The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. [provided by RefSeq, Nov 2014]
Write Your Own Review
You're reviewing:ROMO1 (NM_080748) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210655L1 Lenti ORF clone of Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC210655L2 Lenti ORF clone of Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
RC210655L3 Lenti ORF clone of Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC210655L4 Lenti ORF clone of Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
RG210655 ROMO1 (tGFP-tagged) - Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein 10 ug
$489.00
SC120357 ROMO1 (untagged)-Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.