OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNase II (DNASE2) (NM_001375) Human Mass Spec Standard

Be the first to review this product
SKU
PH309573
DNASE2 MS Standard C13 and N15-labeled recombinant protein (NP_001366)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA305979 Rabbit Polyclonal DNase II Antibody
100 ug
$640.00
LY419982 Transient overexpression lysate of deoxyribonuclease II, lysosomal (DNASE2) (as WB positive control) 100 ug
$436.00

Other products for "DNase II or NM_001375"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209573
Predicted MW 39.6 kDa
Protein Sequence
Protein Sequence
>RC209573 protein sequence
Red=Cloning site Green=Tags(s)

MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINS
PEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPAS
SAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEP
WNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIA
FPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM
ARKPSRAYKI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001366
RefSeq Size 2011
RefSeq ORF 1080
Synonyms DNASE2A; DNL; DNL2
Locus ID 1777
UniProt ID O00115
Cytogenetics 19p13.13
Summary This gene encodes a member of the DNase family. The protein, located in the lysosome, hydrolyzes DNA under acidic conditions and mediates the breakdown of DNA during erythropoiesis and apoptosis. Two codominant alleles have been characterized, DNASE2*L (low activity) and DNASE2*H (high activity), that differ at one nucleotide in the promoter region. The DNASE2*H allele is represented in this record. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Lysosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNase II" proteins (3)
SKU Description Size Price
LC419982 Lyophilized DNASE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419982 Transient overexpression lysate of deoxyribonuclease II, lysosomal (DNASE2) (as WB positive control) 100 ug
$436.00
TP309573 Recombinant protein of human deoxyribonuclease II, lysosomal (DNASE2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products