OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CPSF73 (CPSF3) (NM_016207) Human Mass Spec Standard

Be the first to review this product
SKU
PH305834
CPSF3 MS Standard C13 and N15-labeled recombinant protein (NP_057291)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343845 Rabbit Polyclonal Anti-CPSF3 Antibody
100 ul
$525.00
LY414121 Transient overexpression lysate of cleavage and polyadenylation specific factor 3, 73kDa (CPSF3) (as WB positive control) 100 ug
$436.00

Other products for "CPSF73 or NM_016207"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205834
Predicted MW 77.5 kDa
Protein Sequence
Protein Sequence
>RC205834 protein sequence
Red=Cloning site Green=Tags(s)

MSAIPAEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLIS
HFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINF
HEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIPNIKPDILIIESTYGTH
IHEKREEREARFCNTVHDIVNRGGRGLIPVFALGRAQELLLILDEYWQNHPELHDIPIYYASSLAKKCMA
VYQTYVNAMNDKIRKQININNPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRN
GVIIAGYCVEGTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGE
QNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQRVSGILVKRNF
NYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEP
GMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVK
DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057291
RefSeq Size 2401
RefSeq ORF 2052
Synonyms CPSF-73; CPSF73
Locus ID 51692
UniProt ID Q9UKF6
Cytogenetics 2p25.1
Summary This gene encodes a member of the metallo-beta-lactamase family. The encoded protein is a 73kDa subunit of the cleavage and polyadenylation specificity factor and functions as an endonuclease that recognizes the pre-mRNA 3'-cleavage site AAUAAA prior to polyadenylation. It also cleaves after the pre-mRNA sequence ACCCA during histone 3'-end pre-mRNA processing. provided by RefSeq, Oct 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CPSF73" proteins (4)
SKU Description Size Price
LC414121 Lyophilized CPSF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414121 Transient overexpression lysate of cleavage and polyadenylation specific factor 3, 73kDa (CPSF3) (as WB positive control) 100 ug
$436.00
TP305834 Recombinant protein of human cleavage and polyadenylation specific factor 3, 73kDa (CPSF3), 20 µg 20 ug
$737.00
TP701246 Purified recombinant protein of Human cleavage and polyadenylation specific factor 3, 73kDa (CPSF3), mutant（D75K, H76A）, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20ug 20 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products