CPSF73 (CPSF3) (NM_016207) Human Mass Spec Standard

SKU
PH305834
CPSF3 MS Standard C13 and N15-labeled recombinant protein (NP_057291)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205834]
Predicted MW 77.5 kDa
Protein Sequence
Protein Sequence
>RC205834 protein sequence
Red=Cloning site Green=Tags(s)

MSAIPAEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLIS
HFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINF
HEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIPNIKPDILIIESTYGTH
IHEKREEREARFCNTVHDIVNRGGRGLIPVFALGRAQELLLILDEYWQNHPELHDIPIYYASSLAKKCMA
VYQTYVNAMNDKIRKQININNPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRN
GVIIAGYCVEGTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGE
QNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQRVSGILVKRNF
NYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEP
GMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVK
DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057291
RefSeq Size 2401
RefSeq ORF 2052
Synonyms CPSF-73; CPSF73
Locus ID 51692
UniProt ID Q9UKF6
Cytogenetics 2p25.1
Summary This gene encodes a member of the metallo-beta-lactamase family. The encoded protein is a 73kDa subunit of the cleavage and polyadenylation specificity factor and functions as an endonuclease that recognizes the pre-mRNA 3'-cleavage site AAUAAA prior to polyadenylation. It also cleaves after the pre-mRNA sequence ACCCA during histone 3'-end pre-mRNA processing. [provided by RefSeq, Oct 2012]
Write Your Own Review
You're reviewing:CPSF73 (CPSF3) (NM_016207) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414121 CPSF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414121 Transient overexpression lysate of cleavage and polyadenylation specific factor 3, 73kDa (CPSF3) 100 ug
$436.00
TP305834 Recombinant protein of human cleavage and polyadenylation specific factor 3, 73kDa (CPSF3), 20 µg 20 ug
$737.00
TP701246 Purified recombinant protein of Human cleavage and polyadenylation specific factor 3, 73kDa (CPSF3), mutant(D75K, H76A), with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20ug 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.