CUTC (NM_015960) Human Mass Spec Standard

SKU
PH305748
CUTC MS Standard C13 and N15-labeled recombinant protein (NP_057044)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205748]
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC205748 protein sequence
Red=Cloning site Green=Tags(s)

MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVV
KQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPL
PVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQ
RILEGSGATEFHCSARSTRDSGMKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057044
RefSeq Size 1378
RefSeq ORF 819
Synonyms CGI-32
Locus ID 51076
UniProt ID Q9NTM9
Cytogenetics 10q24.2
Summary Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807]; Li et al., 2005 [PubMed 16182249]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:CUTC (NM_015960) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414278 CUTC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414278 Transient overexpression lysate of cutC copper transporter homolog (E. coli) (CUTC) 100 ug
$436.00
TP305748 Recombinant protein of human cutC copper transporter homolog (E. coli) (CUTC), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.