Monocarboxylic acid transporter 1 (SLC16A1) (NM_003051) Human Mass Spec Standard

SKU
PH305213
SLC16A1 MS Standard C13 and N15-labeled recombinant protein (NP_003042)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205213]
Predicted MW 53.9 kDa
Protein Sequence
Protein Sequence
>RC205213 protein sequence
Red=Cloning site Green=Tags(s)

MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMY
GGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFY
KRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKS
KASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAP
LVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLS
TTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTD
GGPKEEESPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003042
RefSeq Size 3927
RefSeq ORF 1500
Synonyms HHF7; MCT; MCT1; MCT1D
Locus ID 6566
UniProt ID P53985
Cytogenetics 1p13.2
Summary The protein encoded by this gene is a proton-linked monocarboxylate transporter that catalyzes the movement of many monocarboxylates, such as lactate and pyruvate, across the plasma membrane. Mutations in this gene are associated with erythrocyte lactate transporter defect. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Oct 2009]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Monocarboxylic acid transporter 1 (SLC16A1) (NM_003051) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401069 SLC16A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433182 SLC16A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401069 Transient overexpression lysate of solute carrier family 16, member 1 (monocarboxylic acid transporter 1) (SLC16A1), transcript variant 1 100 ug
$436.00
LY433182 Transient overexpression lysate of solute carrier family 16, member 1 (monocarboxylic acid transporter 1) (SLC16A1), transcript variant 2 100 ug
$436.00
TP305213 Recombinant protein of human solute carrier family 16, member 1 (monocarboxylic acid transporter 1) (SLC16A1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.