OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

P2Y12 (P2RY12) (NM_022788) Human Mass Spec Standard

Be the first to review this product
SKU
PH305005
P2RY12 MS Standard C13 and N15-labeled recombinant protein (NP_073625)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA328648 Rabbit Polyclonal Anti-P2Y12 Receptor
50 ul
$930.00
LY402949 Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "P2Y12 or NM_022788"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205005
Predicted MW 39.4 kDa
Protein Sequence
Protein Sequence
>RC205005 protein sequence
Red=Cloning site Green=Tags(s)

MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISD
LLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLG
AKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYT
LITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVK
ESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_073625
RefSeq Size 2318
RefSeq ORF 1026
Synonyms ADPG-R; BDPLT8; HORK3; P2T(AC); P2Y(12)R; P2Y(AC); P2Y(ADP); P2Y(cyc); P2Y12; SP1999
Locus ID 64805
UniProt ID Q9H244
Cytogenetics 3q25.1
Summary The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelet aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Mutations in this gene are implicated in bleeding disorder, platelet type 8 (BDPLT8). Alternative splicing results in multiple transcript variants of this gene. provided by RefSeq, Jul 2013
Protein Families Druggable Genome, GPCR, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "P2Y12" proteins (5)
SKU Description Size Price
LC402949 Lyophilized P2RY12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403587 Lyophilized P2RY12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402949 Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY403587 Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305005 Recombinant protein of human purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products