P2Y12 (P2RY12) (NM_022788) Human Tagged ORF Clone

SKU
RC205005
P2RY12 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol P2Y12
Synonyms ADPG-R; BDPLT8; HORK3; P2T(AC); P2Y(12)R; P2Y(AC); P2Y(ADP); P2Y(cyc); P2Y12; SP1999
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205005 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAAGCCGTCGACAATCTCACCTCTGCGCCTGGGAACACCAGTCTGTGCACCAGAGACTACAAAATCA
CCCAGGTCCTCTTCCCACTGCTCTACACTGTCCTGTTTTTTGTTGGACTTATCACAAATGGCCTGGCGAT
GAGGATTTTCTTTCAAATCCGGAGTAAATCAAACTTTATTATTTTTCTTAAGAACACAGTCATTTCTGAT
CTTCTCATGATTCTGACTTTTCCATTCAAAATTCTTAGTGATGCCAAACTGGGAACAGGACCACTGAGAA
CTTTTGTGTGTCAAGTTACCTCCGTCATATTTTATTTCACAATGTATATCAGTATTTCATTCCTGGGACT
GATAACTATCGATCGCTACCAGAAGACCACCAGGCCATTTAAAACATCCAACCCCAAAAATCTCTTGGGG
GCTAAGATTCTCTCTGTTGTCATCTGGGCATTCATGTTCTTACTCTCTTTGCCTAACATGATTCTGACCA
ACAGGCAGCCGAGAGACAAGAATGTGAAGAAATGCTCTTTCCTTAAATCAGAGTTCGGTCTAGTCTGGCA
TGAAATAGTAAATTACATCTGTCAAGTCATTTTCTGGATTAATTTCTTAATTGTTATTGTATGTTATACA
CTCATTACAAAAGAACTGTACCGGTCATACGTAAGAACGAGGGGTGTAGGTAAAGTCCCCAGGAAAAAGG
TGAACGTCAAAGTTTTCATTATCATTGCTGTATTCTTTATTTGTTTTGTTCCTTTCCATTTTGCCCGAAT
TCCTTACACCCTGAGCCAAACCCGGGATGTCTTTGACTGCACTGCTGAAAATACTCTGTTCTATGTGAAA
GAGAGCACTCTGTGGTTAACTTCCTTAAATGCATGCCTGGATCCGTTCATCTATTTTTTCCTTTGCAAGT
CCTTCAGAAATTCCTTGATAAGTATGCTGAAGTGCCCCAATTCTGCAACATCTCTGTCCCAGGACAATAG
GAAAAAAGAACAGGATGGTGGTGACCCAAATGAAGAGACTCCAATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205005 protein sequence
Red=Cloning site Green=Tags(s)

MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISD
LLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLG
AKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYT
LITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVK
ESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_022788
ORF Size 1026 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022788.2
RefSeq Size 2318 bp
RefSeq ORF 1029 bp
Locus ID 64805
UniProt ID Q9H244
Cytogenetics 3q25.1
Domains 7tm_1
Protein Families Druggable Genome, GPCR, Transmembrane
MW 39.4 kDa
Summary The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelet aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Mutations in this gene are implicated in bleeding disorder, platelet type 8 (BDPLT8). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:P2Y12 (P2RY12) (NM_022788) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205005L1 Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC205005L2 Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1, mGFP tagged 10 ug
$986.00
RC205005L3 Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC205005L4 Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1, mGFP tagged 10 ug
$986.00
RG205005 P2RY12 (tGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1 10 ug
$886.00
SC319680 P2RY12 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.