OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHMP4C (NM_152284) Human Mass Spec Standard

Be the first to review this product
SKU
PH304802
CHMP4C MS Standard C13 and N15-labeled recombinant protein (NP_689497)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA890004 Rabbit polyclonal CHMP4C Antibody
100 ul
$407.00
LY407666 Transient overexpression lysate of chromatin modifying protein 4C (CHMP4C) (as WB positive control) 100 ug
$436.00

Other products for "CHMP4C or NM_152284"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204802
Predicted MW 26.2 kDa
Protein Sequence
Protein Sequence
>RC204802 representing NM_152284
Red=Cloning site Green=Tags(s)

MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK
RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD
IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS
RAASSQRAEEEDDDIKQLAAWAT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689497
RefSeq Size 1847
RefSeq ORF 699
Synonyms Shax3; SNF7-3; VPS32C
Locus ID 92421
UniProt ID Q96CF2
Cytogenetics 8q21.13
Summary CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 PubMed 16730941).supplied by OMIM, Mar 2008
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CHMP4C" proteins (3)
SKU Description Size Price
LC407666 Lyophilized CHMP4C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407666 Transient overexpression lysate of chromatin modifying protein 4C (CHMP4C) (as WB positive control) 100 ug
$436.00
TP304802 Recombinant protein of human chromatin modifying protein 4C (CHMP4C), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products