CHMP4C (NM_152284) Human Tagged ORF Clone

SKU
RC204802
CHMP4C (Myc-DDK-tagged)-Human chromatin modifying protein 4C (CHMP4C)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CHMP4C
Synonyms Shax3; SNF7-3; VPS32C
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204802 representing NM_152284
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAAGTTGGGCAAGTTCTTTAAAGGGGGCGGCTCTTCTAAGAGCCGAGCCGCTCCCAGTCCCCAGG
AGGCCCTGGTCCGACTTCGGGAGACTGAGGAGATGCTGGGCAAGAAACAAGAGTACCTGGAAAATCGAAT
CCAGAGAGAAATCGCCCTGGCCAAGAAGCACGGCACGCAGAATAAGCGAGCTGCATTACAGGCACTAAAG
AGAAAGAAGAGGTTCGAGAAACAGCTCACTCAGATTGATGGCACACTTTCTACCATTGAGTTCCAGAGAG
AAGCCCTGGAGAACTCACACACCAACACTGAGGTGTTGAGGAACATGGGCTTTGCAGCAAAAGCGATGAA
ATCTGTTCATGAAAACATGGATCTGAACAAAATAGATGATTTGATGCAAGAGATCACAGAGCAACAGGAT
ATCGCCCAAGAAATCTCAGAAGCATTTTCTCAACGGGTTGGCTTTGGTGATGACTTTGATGAGGATGAGT
TGATGGCAGAACTTGAAGAATTGGAACAGGAGGAATTAAATAAGAAGATGACAAATATCCGCCTTCCAAA
TGTGCCTTCCTCTTCTCTCCCAGCACAGCCAAATAGAAAACCAGGCATGTCGTCCACTGCACGTCGATCC
CGAGCAGCATCTTCCCAGAGGGCAGAAGAAGAGGATGATGATATCAAACAATTGGCAGCTTGGGCTACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204802 representing NM_152284
Red=Cloning site Green=Tags(s)

MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK
RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD
IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS
RAASSQRAEEEDDDIKQLAAWAT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152284
ORF Size 699 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152284.4
RefSeq Size 1847 bp
RefSeq ORF 702 bp
Locus ID 92421
UniProt ID Q96CF2
Cytogenetics 8q21.13
Protein Pathways Endocytosis
MW 26.2 kDa
Summary CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:CHMP4C (NM_152284) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204802L1 Lenti ORF clone of Human chromatin modifying protein 4C (CHMP4C), Myc-DDK-tagged 10 ug
$600.00
RC204802L2 Lenti ORF clone of Human chromatin modifying protein 4C (CHMP4C), mGFP tagged 10 ug
$600.00
RC204802L3 Lenti ORF clone of Human chromatin modifying protein 4C (CHMP4C), Myc-DDK-tagged 10 ug
$600.00
RC204802L4 Lenti ORF clone of Human chromatin modifying protein 4C (CHMP4C), mGFP tagged 10 ug
$600.00
RG204802 CHMP4C (tGFP-tagged) - Human chromatin modifying protein 4C (CHMP4C) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC324478 CHMP4C (untagged)-Human chromatin modifying protein 4C (CHMP4C) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.