HOPX (NM_139211) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC204361] |
Predicted MW | 8.3 kDa |
Protein Sequence |
Protein Sequence
>RC204361 protein sequence
Red=Cloning site Green=Tags(s) MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS VID myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_631957 |
RefSeq Size | 1154 |
RefSeq ORF | 219 |
Synonyms | CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO |
Locus ID | 84525 |
UniProt ID | Q9BPY8 |
Cytogenetics | 4q12 |
Summary | The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Feb 2009] |
Protein Families | Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH322859 | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_115884) | 10 ug |
$3,255.00
|
|
PH322903 | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631958) | 10 ug |
$3,255.00
|
|
LC408356 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408357 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC410073 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428902 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY408356 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 2 | 100 ug |
$436.00
|
|
LY408357 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 3 | 100 ug |
$436.00
|
|
LY410073 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 1 | 100 ug |
$436.00
|
|
LY428902 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 4 | 100 ug |
$436.00
|
|
TP304361 | Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP322859 | Recombinant protein of human HOP homeobox (HOPX), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP322903 | Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.