HOPX (NM_032495) Human Recombinant Protein

SKU
TP322859
Recombinant protein of human HOP homeobox (HOPX), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222859 protein sequence
Red=Cloning site Green=Tags(s)

MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS
VID

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 8.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115884
Locus ID 84525
UniProt ID Q9BPY8
Cytogenetics 4q12
RefSeq Size 1552
RefSeq ORF 219
Synonyms CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO
Summary The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Feb 2009]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:HOPX (NM_032495) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304361 HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631957) 10 ug
$3,255.00
PH322859 HOPX MS Standard C13 and N15-labeled recombinant protein (NP_115884) 10 ug
$3,255.00
PH322903 HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631958) 10 ug
$3,255.00
LC408356 HOPX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408357 HOPX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410073 HOPX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428902 HOPX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408356 Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 2 100 ug
$436.00
LY408357 Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 3 100 ug
$436.00
LY410073 Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 1 100 ug
$436.00
LY428902 Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 4 100 ug
$436.00
TP304361 Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322903 Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.