HOPX (NM_139211) Human Tagged ORF Clone

SKU
RC204361
HOPX (Myc-DDK-tagged)-Human HOP homeobox (HOPX), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$225.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HOPX
Synonyms CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204361 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCGGAGACCGCGAGCGGCCCCACAGAGGACCAGGTGGAAATCCTGGAGTACAACTTCAACAAGG
TCGACAAGCACCCGGATTCCACCACGCTGTGCCTCATCGCGGCCGAGGCAGGCCTTTCCGAGGAGGAGAC
CCAGAAATGGTTTAAGCAGCGCCTGGCAAAGTGGCGGCGCTCAGAAGGCCTGCCCTCAGAGTGCAGATCC
GTCATAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204361 protein sequence
Red=Cloning site Green=Tags(s)

MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS
VID

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_139211
ORF Size 219 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_139211.4
RefSeq Size 1154 bp
RefSeq ORF 222 bp
Locus ID 84525
UniProt ID Q9BPY8
Cytogenetics 4q12
Protein Families Transcription Factors
MW 8.3 kDa
Summary The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:HOPX (NM_139211) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204361L1 Lenti-ORF clone of HOPX (Myc-DDK-tagged)-Human HOP homeobox (HOPX), transcript variant 2 10 ug
$525.00
RC204361L2 Lenti-ORF clone of HOPX (mGFP-tagged)-Human HOP homeobox (HOPX), transcript variant 2 10 ug
$525.00
RC204361L3 Lenti-ORF clone of HOPX (Myc-DDK-tagged)-Human HOP homeobox (HOPX), transcript variant 2 10 ug
$525.00
RC204361L4 Lenti-ORF clone of HOPX (mGFP-tagged)-Human HOP homeobox (HOPX), transcript variant 2 10 ug
$525.00
RG204361 HOPX (tGFP-tagged) - Human HOP homeobox (HOPX), transcript variant 2 10 ug
$425.00
SC124255 HOPX (untagged)-Human HOP homeobox (HOPX), transcript variant 2 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.