OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Superoxide Dismutase 3 (SOD3) (NM_003102) Human Mass Spec Standard

Be the first to review this product
SKU
PH304156
SOD3 MS Standard C13 and N15-labeled recombinant protein (NP_003093)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418899 Transient overexpression lysate of superoxide dismutase 3, extracellular (SOD3) (as WB positive control) 100 ug
$436.00

Other products for "Superoxide Dismutase 3 or NM_003102"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204156
Predicted MW 25.9 kDa
Protein Sequence
Protein Sequence
>RC204156 protein sequence
Red=Cloning site Green=Tags(s)

MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSAT
LDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHP
QHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVV
GVCGPGLWERQAREHSERKKRRRESECKAA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003093
RefSeq Size 1546
RefSeq ORF 720
Synonyms EC-SOD
Locus ID 6649
UniProt ID P08294
Cytogenetics 4p15.2
Summary This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the conversion of superoxide radicals into hydrogen peroxide and oxygen, which may protect the brain, lungs, and other tissues from oxidative stress. Proteolytic processing of the encoded protein results in the formation of two distinct homotetramers that differ in their ability to interact with the extracellular matrix (ECM). Homotetramers consisting of the intact protein, or type C subunit, exhibit high affinity for heparin and are anchored to the ECM. Homotetramers consisting of a proteolytically cleaved form of the protein, or type A subunit, exhibit low affinity for heparin and do not interact with the ECM. A mutation in this gene may be associated with increased heart disease risk. provided by RefSeq, Oct 2015
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Superoxide Dismutase 3" proteins (3)
SKU Description Size Price
LC418899 Lyophilized SOD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418899 Transient overexpression lysate of superoxide dismutase 3, extracellular (SOD3) (as WB positive control) 100 ug
$436.00
TP304156 Recombinant protein of human superoxide dismutase 3, extracellular (SOD3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products