SQSTM1 (NM_003900) Human Mass Spec Standard

SKU
PH303214
SQSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_003891)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203214]
Predicted MW 47.7 kDa
Protein Sequence
Protein Sequence
>RC203214 protein sequence
Red=Cloning site Green=Tags(s)

MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDE
DGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRY
KCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRP
PRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEE
KSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPST
GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003891
RefSeq Size 2923
RefSeq ORF 1320
Synonyms A170; DMRV; FTDALS3; NADGP; OSIL; p60; p62; p62B; PDB3; ZIP3
Locus ID 8878
UniProt ID Q13501
Cytogenetics 5q35.3
Summary This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone. [provided by RefSeq, Mar 2009]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:SQSTM1 (NM_003900) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401285 SQSTM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428020 SQSTM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401285 Transient overexpression lysate of sequestosome 1 (SQSTM1), transcript variant 1 100 ug
$436.00
LY428020 Transient overexpression lysate of sequestosome 1 (SQSTM1), transcript variant 2 100 ug
$436.00
TP303214 Recombinant protein of human sequestosome 1 (SQSTM1), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.