NQO2 (NM_000904) Human Mass Spec Standard

SKU
PH302889
NQO2 MS Standard C13 and N15-labeled recombinant protein (NP_000895)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202889]
Predicted MW 26 kDa
Protein Sequence
Protein Sequence
>RC202889 protein sequence
Red=Cloning site Green=Tags(s)

MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRATDKDITGTLSNPEVFNYGV
ETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQG
KLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEERKGMVAAWSQ
RLQTIWKEEPIPCTAHWHFGQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000895
RefSeq Size 1272
RefSeq ORF 693
Synonyms DHQV; DIA6; NMOR2; QR2
Locus ID 4835
UniProt ID P16083
Cytogenetics 6p25.2
Summary This gene encodes a member of the thioredoxin family of enzymes. It is a cytosolic and ubiquitously expressed flavoprotein that catalyzes the two-electron reduction of quinone substrates and uses dihydronicotinamide riboside as a reducing coenzyme. Mutations in this gene have been associated with neurodegenerative diseases and several cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Write Your Own Review
You're reviewing:NQO2 (NM_000904) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424463 NQO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424463 Transient overexpression lysate of NAD(P)H dehydrogenase, quinone 2 (NQO2) 100 ug
$436.00
TP302889 Recombinant protein of human NAD(P)H dehydrogenase, quinone 2 (NQO2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.