NQO2 (NM_000904) Human Tagged ORF Clone

SKU
RC202889
NQO2 (Myc-DDK-tagged)-Human NAD(P)H dehydrogenase, quinone 2 (NQO2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NQO2
Synonyms DHQV; DIA6; NMOR2; QR2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202889 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGGTAAGAAAGTACTCATTGTCTATGCACACCAGGAACCCAAGTCTTTCAACGGATCCTTGAAGA
ATGTGGCTGTAGATGAACTGAGCAGGCAGGGCTGCACCGTCACAGTGTCTGATTTGTATGCCATGAACTT
TGAGCCGAGGGCCACAGACAAAGATATCACTGGTACTCTTTCTAATCCTGAGGTTTTCAATTATGGAGTG
GAAACCCACGAAGCCTACAAGCAAAGGTCTCTGGCTAGCGACATCACTGATGAGCAGAAAAAGGTTCGGG
AGGCTGACCTAGTGATATTTCAGTTCCCGCTGTACTGGTTCAGCGTGCCGGCCATCCTGAAGGGCTGGAT
GGATAGGGTGCTGTGCCAGGGCTTTGCCTTTGACATCCCAGGATTCTACGATTCCGGTTTGCTCCAGGGT
AAACTAGCGCTCCTTTCCGTAACCACGGGAGGCACGGCCGAGATGTACACGAAGACAGGAGTCAATGGAG
ATTCTCGATACTTCCTGTGGCCACTCCAGCATGGCACATTACACTTCTGTGGATTTAAAGTCCTTGCCCC
TCAGATCAGCTTTGCTCCTGAAATTGCATCCGAAGAAGAAAGAAAGGGGATGGTGGCTGCGTGGTCCCAG
AGGCTGCAGACCATCTGGAAGGAAGAGCCCATCCCCTGCACAGCCCACTGGCACTTCGGGCAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202889 protein sequence
Red=Cloning site Green=Tags(s)

MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRATDKDITGTLSNPEVFNYGV
ETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQG
KLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEERKGMVAAWSQ
RLQTIWKEEPIPCTAHWHFGQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000904
ORF Size 693 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000904.2
RefSeq Size 1272 bp
RefSeq ORF 696 bp
Locus ID 4835
UniProt ID P16083
Cytogenetics 6p25.2
Domains Flavodoxin_2
MW 26 kDa
Summary This gene encodes a member of the thioredoxin family of enzymes. It is a cytosolic and ubiquitously expressed flavoprotein that catalyzes the two-electron reduction of quinone substrates and uses dihydronicotinamide riboside as a reducing coenzyme. Mutations in this gene have been associated with neurodegenerative diseases and several cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Write Your Own Review
You're reviewing:NQO2 (NM_000904) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202889L1 Lenti ORF clone of Human NAD(P)H dehydrogenase, quinone 2 (NQO2), Myc-DDK-tagged 10 ug
$600.00
RC202889L2 Lenti ORF clone of Human NAD(P)H dehydrogenase, quinone 2 (NQO2), mGFP tagged 10 ug
$600.00
RC202889L3 Lenti ORF clone of Human NAD(P)H dehydrogenase, quinone 2 (NQO2), Myc-DDK-tagged 10 ug
$600.00
RC202889L4 Lenti ORF clone of Human NAD(P)H dehydrogenase, quinone 2 (NQO2), mGFP tagged 10 ug
$600.00
RG202889 NQO2 (tGFP-tagged) - Human NAD(P)H dehydrogenase, quinone 2 (NQO2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319150 NQO2 (untagged)-Human NAD(P)H dehydrogenase, quinone 2 (NQO2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.