Optineurin (OPTN) (NM_001008211) Human Mass Spec Standard

SKU
PH302470
OPTN MS Standard C13 and N15-labeled recombinant protein (NP_001008212)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202470]
Predicted MW 65.9 kDa
Protein Sequence
Protein Sequence
>RC202470 protein sequence
Red=Cloning site Green=Tags(s)

MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFE
ELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEK
DQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTA
LSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEG
STEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNE
KQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDR
AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKE
QLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGE
VLPDIDTLQIHVMDCII

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001008212
RefSeq Size 3597
RefSeq ORF 1731
Synonyms ALS12; FIP2; GLC1E; HIP7; HYPL; NRP; TFIIIA-INTP
Locus ID 10133
UniProt ID Q96CV9
Cytogenetics 10p13
Summary This gene encodes the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Optineurin (OPTN) (NM_001008211) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411824 OPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423390 OPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423391 OPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423392 OPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425228 OPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425229 OPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411824 Transient overexpression lysate of optineurin (OPTN), transcript variant 2 100 ug
$436.00
LY423390 Transient overexpression lysate of optineurin (OPTN), transcript variant 1 100 ug
$436.00
LY423391 Transient overexpression lysate of optineurin (OPTN), transcript variant 3 100 ug
$665.00
LY423392 Transient overexpression lysate of optineurin (OPTN), transcript variant 4 100 ug
$665.00
LY425228 Transient overexpression lysate of optineurin (OPTN), transcript variant 3 100 ug
$436.00
LY425229 Transient overexpression lysate of optineurin (OPTN), transcript variant 4 100 ug
$436.00
TP302470 Recombinant protein of human optineurin (OPTN), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.