OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRIM21 (NM_003141) Human Mass Spec Standard

Be the first to review this product
SKU
PH302088
TRIM21 MS Standard C13 and N15-labeled recombinant protein (NP_003132)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA382809 TRIM21 Rabbit polyclonal Antibody
100 ul
$410.00
LY401090 Transient overexpression lysate of tripartite motif-containing 21 (TRIM21) (as WB positive control) 100 ug
$436.00

Other products for "TRIM21 or NM_003141"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202088
Predicted MW 54.2 kDa
Protein Sequence
Protein Sequence
>RC202088 protein sequence
Red=Cloning site Green=Tags(s)

MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLA
NMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQ
VALGELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRI
LGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKK
MLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTG
KEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF
YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003132
RefSeq Size 1946
RefSeq ORF 1425
Synonyms RNF81; Ro/SSA; RO52; SSA; SSA1
Locus ID 6737
UniProt ID P19474
Cytogenetics 11p15.4
Summary This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Systemic lupus erythematosus
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRIM21" proteins (3)
SKU Description Size Price
LC401090 Lyophilized TRIM21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401090 Transient overexpression lysate of tripartite motif-containing 21 (TRIM21) (as WB positive control) 100 ug
$436.00
TP302088 Recombinant protein of human tripartite motif-containing 21 (TRIM21), 20 µg 20 ug
$867.00

file-alt Citations

TRIM21, a negative modulator of LFG in breast carcinoma MDA-MB-231 cells in vitro
Müller, Maurer, Reimers et al
Int. J. Oncol. (2015)
Cited by 13
AI Summary: OriGene's pCMV6-AC-GFP vector (NM_003141) was used to clone various TRIM21 constructs, enabling the study of TRIM21’s interaction with LFG and its regulatory effects in breast carcinoma MDA-MB-231 cells.
Snippet: TRIM21 vectors. To identify the essential domain for the inter- action between TRIM21 and LFG, different vectors, using pCMV6-AC-GFP vector (NM_003141;OriGene, Cambridge, UK) were cloned containing the sequences of TRIM21 with the deletion of an entire ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products