CENPA (NM_001042426) Human Mass Spec Standard

SKU
PH301602
CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001035891)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201602]
Predicted MW 13 kDa
Protein Sequence
Protein Sequence
>RC201602 protein sequence
Red=Cloning site Green=Tags(s)

MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL
AAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035891
RefSeq Size 1352
RefSeq ORF 342
Synonyms CenH3; CENP-A
Locus ID 1058
UniProt ID P49450
Cytogenetics 2p23.3
Summary Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:CENPA (NM_001042426) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH324761 CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001800) 10 ug
$3,255.00
LC400687 CENPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420896 CENPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400687 Transient overexpression lysate of centromere protein A (CENPA), transcript variant 1 100 ug
$436.00
LY420896 Transient overexpression lysate of centromere protein A (CENPA), transcript variant 2 100 ug
$436.00
TP301602 Recombinant protein of human centromere protein A (CENPA), transcript variant 2, 20 µg 20 ug
$867.00
TP324761 Recombinant protein of human centromere protein A (CENPA), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.