OriGene Logo

CENPA (NM_001809) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP324761
Recombinant protein of human centromere protein A (CENPA), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
In Control Promo
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA338983 Rabbit Polyclonal Anti-CENPA Antibody
100 ul
$525.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CENPA or NM_001809"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224761 representing NM_001809
Red=Cloning site Green=Tags(s)

MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL
AREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001800
Locus ID 1058
UniProt ID P49450
Cytogenetics 2p23.3
RefSeq Size 1389
RefSeq ORF 420
Synonyms CenH3; CENP-A
Summary Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. provided by RefSeq, Nov 2015
Protein Categories Cytokines, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "CENPA" proteins (7)
SKU Description Size Price
PH301602 CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001035891) 10 ug
$3,360.00
PH324761 CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001800) 10 ug
$3,360.00
LC400687 CENPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420896 CENPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400687 Transient overexpression lysate of centromere protein A (CENPA), transcript variant 1 100 ug
$436.00
LY420896 Transient overexpression lysate of centromere protein A (CENPA), transcript variant 2 100 ug
$436.00
TP301602 Recombinant protein of human centromere protein A (CENPA), transcript variant 2, 20 µg 20 ug
$867.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.