CENPA (NM_001042426) Human Tagged ORF Clone

SKU
RC201602
CENPA (Myc-DDK-tagged)-Human centromere protein A (CENPA), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CENPA
Synonyms CenH3; CENP-A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201602 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCCGCGCCGCCGGAGCCGAAAGCCCGAGGCCCCGAGGAGGCGCAGCCCGAGCCCGACCCCGACCC
CCGGCCCCTCCCGGCGGGGCCCCTCCTTAGGCGCTTCCTCCCATCAACACAGTCGGCGGAGACAAGGTTG
GCTAAAGGAGATCCGAAAGCTTCAGAAGAGCACACACCTCTTGATAAGGAAGCTGCCCTTCAGCCGCCTG
GCAGCAGAAGCATTTCTAGTTCATCTCTTTGAGGACGCCTATCTCCTCACCTTACATGCAGGCCGAGTTA
CTCTCTTCCCAAAGGATGTGCAACTGGCCCGGAGGATCCGGGGCCTTGAGGAGGGACTCGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201602 protein sequence
Red=Cloning site Green=Tags(s)

MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL
AAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001042426
ORF Size 342 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001042426.1, NP_001035891.1
RefSeq Size 1352 bp
RefSeq ORF 345 bp
Locus ID 1058
UniProt ID P49450
Cytogenetics 2p23.3
MW 13 kDa
Summary Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:CENPA (NM_001042426) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201602L3 Lenti ORF clone of Human centromere protein A (CENPA), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC201602L4 Lenti ORF clone of Human centromere protein A (CENPA), transcript variant 2, mGFP tagged 10 ug
$450.00
RG201602 CENPA (tGFP-tagged) - Human centromere protein A (CENPA), transcript variant 2 10 ug
$489.00
SC322212 CENPA (untagged)-Human centromere protein A (CENPA), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.