Argininosuccinate Lyase (ASL) (NM_001024943) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201568] |
Predicted MW | 51.7 kDa |
Protein Sequence |
Protein Sequence
>RC201568 protein sequence
Red=Cloning site Green=Tags(s) MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKV AEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELI RTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLG VDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTG SSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVI STLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001020114 |
RefSeq Size | 2061 |
RefSeq ORF | 1392 |
Synonyms | ASAL |
Locus ID | 435 |
UniProt ID | P04424 |
Cytogenetics | 7q11.21 |
Summary | This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alanine, Arginine and proline metabolism, aspartate and glutamate metabolism, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317527 | ASL MS Standard C13 and N15-labeled recombinant protein (NP_000039) | 10 ug |
$3,255.00
|
|
LC422562 | ASL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422563 | ASL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422564 | ASL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424953 | ASL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY422562 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 1 | 100 ug |
$436.00
|
|
LY422563 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 3 | 100 ug |
$665.00
|
|
LY422564 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 4 | 100 ug |
$665.00
|
|
LY424953 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 2 | 100 ug |
$665.00
|
|
TP301568 | Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP317527 | Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.