Argininosuccinate Lyase (ASL) (NM_001024943) Human Mass Spec Standard

SKU
PH301568
ASL MS Standard C13 and N15-labeled recombinant protein (NP_001020114)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201568]
Predicted MW 51.7 kDa
Protein Sequence
Protein Sequence
>RC201568 protein sequence
Red=Cloning site Green=Tags(s)

MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKV
AEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELI
RTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLG
VDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTG
SSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVI
STLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF
SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020114
RefSeq Size 2061
RefSeq ORF 1392
Synonyms ASAL
Locus ID 435
UniProt ID P04424
Cytogenetics 7q11.21
Summary This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Protein Pathways Alanine, Arginine and proline metabolism, aspartate and glutamate metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:Argininosuccinate Lyase (ASL) (NM_001024943) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317527 ASL MS Standard C13 and N15-labeled recombinant protein (NP_000039) 10 ug
$3,255.00
LC422562 ASL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422563 ASL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422564 ASL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424953 ASL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422562 Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 1 100 ug
$436.00
LY422563 Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 3 100 ug
$665.00
LY422564 Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 4 100 ug
$665.00
LY424953 Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 2 100 ug
$665.00
TP301568 Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 1, 20 µg 20 ug
$867.00
TP317527 Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.