S adenosylhomocysteine hydrolase (AHCY) (NM_000687) Human Mass Spec Standard

SKU
PH300724
AHCY MS Standard C13 and N15-labeled recombinant protein (NP_000678)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200724]
Predicted MW 47.7 kDa
Protein Sequence
Protein Sequence
>RC200724 protein sequence
Red=Cloning site Green=Tags(s)

MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTL
GAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIH
TKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVM
IAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCID
IILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCA
MGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000678
RefSeq Size 2211
RefSeq ORF 1296
Synonyms adoHcyase; SAHH
Locus ID 191
UniProt ID P23526
Cytogenetics 20q11.22
Summary S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. It catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2009]
Protein Families Druggable Genome
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism
Write Your Own Review
You're reviewing:S adenosylhomocysteine hydrolase (AHCY) (NM_000687) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400228 AHCY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400228 Transient overexpression lysate of adenosylhomocysteinase (AHCY), transcript variant 1 100 ug
$436.00
TP300724 Recombinant protein of human S-adenosylhomocysteine hydrolase (AHCY), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.