OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

S adenosylhomocysteine hydrolase (AHCY) (NM_000687) Human Mass Spec Standard

Be the first to review this product
SKU
PH300724
AHCY MS Standard C13 and N15-labeled recombinant protein (NP_000678)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA332593 Rabbit anti-AHCY Polyclonal Antibody
100 ul
$410.00
LY400228 Transient overexpression lysate of adenosylhomocysteinase (AHCY), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "S adenosylhomocysteine hydrolase or NM_000687"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200724
Predicted MW 47.7 kDa
Protein Sequence
Protein Sequence
>RC200724 protein sequence
Red=Cloning site Green=Tags(s)

MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTL
GAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIH
TKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVM
IAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCID
IILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCA
MGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000678
RefSeq Size 2211
RefSeq ORF 1296
Synonyms adoHcyase; SAHH
Locus ID 191
UniProt ID P23526
Cytogenetics 20q11.22
Summary S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. It catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jun 2009
Protein Families Druggable Genome
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "S adenosylhomocysteine hydrolase" proteins (3)
SKU Description Size Price
LC400228 Lyophilized AHCY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400228 Transient overexpression lysate of adenosylhomocysteinase (AHCY), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300724 Recombinant protein of human S-adenosylhomocysteine hydrolase (AHCY), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products