RAB6A (NM_002869) Human Mass Spec Standard

SKU
PH300432
RAB6A MS Standard C13 and N15-labeled recombinant protein (NP_002860)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200432]
Predicted MW 23.5 kDa
Protein Sequence
Protein Sequence
>RC200432 protein sequence
Red=Cloning site Green=Tags(s)

MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTA
GQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE
GERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002860
RefSeq Size 3419
RefSeq ORF 624
Synonyms RAB6
Locus ID 5870
UniProt ID P20340
Cytogenetics 11q13.4
Summary This gene encodes a member of the RAB family, which belongs to the small GTPase superfamily. GTPases of the RAB family bind to various effectors to regulate the targeting and fusion of transport carriers to acceptor compartments. This protein is located at the Golgi apparatus, which regulates trafficking in both a retrograde (from early endosomes and Golgi to the endoplasmic reticulum) and an anterograde (from the Golgi to the plasma membrane) directions. Myosin II is an effector of this protein in these processes. This protein is also involved in assembly of human cytomegalovirus (HCMV) by interacting with the cellular protein Bicaudal D1, which interacts with the HCMV virion tegument protein, pp150. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB6A (NM_002869) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310594 RAB6A MS Standard C13 and N15-labeled recombinant protein (NP_942599) 10 ug
$3,255.00
LC404772 RAB6A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419062 RAB6A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404772 Transient overexpression lysate of RAB6A, member RAS oncogene family (RAB6A), transcript variant 2 100 ug
$436.00
LY419062 Transient overexpression lysate of RAB6A, member RAS oncogene family (RAB6A), transcript variant 1 100 ug
$436.00
TP300432 Recombinant protein of human RAB6A, member RAS oncogene family (RAB6A), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310594 Recombinant protein of human RAB6A, member RAS oncogene family (RAB6A), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.