RAB6A (NM_198896) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210594] |
Predicted MW | 23.6 kDa |
Protein Sequence |
Protein Sequence
>RC210594 protein sequence
Red=Cloning site Green=Tags(s) MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA GQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE GERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_942599 |
RefSeq Size | 3419 |
RefSeq ORF | 624 |
Synonyms | RAB6 |
Locus ID | 5870 |
UniProt ID | P20340 |
Cytogenetics | 11q13.4 |
Summary | This gene encodes a member of the RAB family, which belongs to the small GTPase superfamily. GTPases of the RAB family bind to various effectors to regulate the targeting and fusion of transport carriers to acceptor compartments. This protein is located at the Golgi apparatus, which regulates trafficking in both a retrograde (from early endosomes and Golgi to the endoplasmic reticulum) and an anterograde (from the Golgi to the plasma membrane) directions. Myosin II is an effector of this protein in these processes. This protein is also involved in assembly of human cytomegalovirus (HCMV) by interacting with the cellular protein Bicaudal D1, which interacts with the HCMV virion tegument protein, pp150. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300432 | RAB6A MS Standard C13 and N15-labeled recombinant protein (NP_002860) | 10 ug |
$3,255.00
|
|
LC404772 | RAB6A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419062 | RAB6A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404772 | Transient overexpression lysate of RAB6A, member RAS oncogene family (RAB6A), transcript variant 2 | 100 ug |
$436.00
|
|
LY419062 | Transient overexpression lysate of RAB6A, member RAS oncogene family (RAB6A), transcript variant 1 | 100 ug |
$436.00
|
|
TP300432 | Recombinant protein of human RAB6A, member RAS oncogene family (RAB6A), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP310594 | Recombinant protein of human RAB6A, member RAS oncogene family (RAB6A), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.