REC8 (NM_005132) Human Mass Spec Standard

SKU
PH300132
REC8 MS Standard C13 and N15-labeled recombinant protein (NP_005123)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200132]
Predicted MW 62.6 kDa
Protein Sequence
Protein Sequence
>RC200132 protein sequence
Red=Cloning site Green=Tags(s)

MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVLVRVQPPQPGLPRPRFSLYLS
AQLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPNHLAMMETLEDAPDPFFGMM
SVDPRLPSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGE
RELPEVSRRELDLLIAEEEEAILLEIPRLPPPAPAEVEGIGEALGPEELRLTGWEPGALLMEVTPPEELR
LPAPPSPERRPPVPPPPRRRRRRRLLFWDKETQISPEKFQEQLQTRAHCWECPMVQPPERTIRGPAELFR
TPTLSGWLPPELLGLWTHCAQPPPKALRRELPEEAAAEEERRKIEVPSEIEVPREALEPSVPLMVSLEIS
LEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALEL
QANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005123
RefSeq Size 2253
RefSeq ORF 1641
Synonyms HR21spB; REC8L1; Rec8p
Locus ID 9985
UniProt ID O95072
Cytogenetics 14q12
Summary This gene encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Pathways Oocyte meiosis
Write Your Own Review
You're reviewing:REC8 (NM_005132) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401575 REC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420781 REC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401575 Transient overexpression lysate of REC8 homolog (yeast) (REC8), transcript variant 1 100 ug
$436.00
LY420781 Transient overexpression lysate of REC8 homolog (yeast) (REC8), transcript variant 2 100 ug
$665.00
TP300132 Recombinant protein of human REC8 homolog (yeast) (REC8), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.