SCAND1 (NM_033630) Human Mass Spec Standard

SKU PH300079

SCAND1 MS Standard C13 and N15-labeled recombinant protein (NP_361012)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200079]
• Predicted MW: 19.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC200079 protein sequence; Red=Cloning site Green=Tags(s); ; MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEAIPTPRAAASA; ALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPD; IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_361012
• RefSeq Size: 919
• RefSeq ORF: 537
• Synonyms: RAZ1; SDP1
• Locus ID: 51282
• UniProt ID: H0UIA5
• Cytogenetics: 20q11.23
• Summary: This gene encodes a SCAN box domain-containing protein. The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. This protein binds to and may regulate the function of the transcription factor myeloid zinc finger 1B. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011]
• Protein Families: Transcription Factors