SCAND1 (NM_016558) Human Mass Spec Standard

SKU
PH304370
SCAND1 MS Standard C13 and N15-labeled recombinant protein (NP_057642)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204370]
Predicted MW 19.1 kDa
Protein Sequence
Protein Sequence
>RC204370 protein sequence
Red=Cloning site Green=Tags(s)

MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEAIPTPRAAASA
ALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPD
IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057642
RefSeq Size 1388
RefSeq ORF 537
Synonyms RAZ1; SDP1
Locus ID 51282
UniProt ID P57086
Cytogenetics 20q11.23
Summary This gene encodes a SCAN box domain-containing protein. The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. This protein binds to and may regulate the function of the transcription factor myeloid zinc finger 1B. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:SCAND1 (NM_016558) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300079 SCAND1 MS Standard C13 and N15-labeled recombinant protein (NP_361012) 10 ug
$3,255.00
LC409491 SCAND1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413912 SCAND1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409491 Transient overexpression lysate of SCAN domain containing 1 (SCAND1), transcript variant 2 100 ug
$436.00
LY413912 Transient overexpression lysate of SCAN domain containing 1 (SCAND1), transcript variant 1 100 ug
$436.00
TP300079 Recombinant protein of human SCAN domain containing 1 (SCAND1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP304370 Recombinant protein of human SCAN domain containing 1 (SCAND1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.