PDAP1 (NM_014891) Human Mass Spec Standard

SKU
PH300058
PDAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055706)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200058]
Predicted MW 20.6 kDa
Protein Sequence
Protein Sequence
>RC200058 protein sequence
Red=Cloning site Green=Tags(s)

MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDY
QQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADL
ARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055706
RefSeq Size 2707
RefSeq ORF 543
Synonyms HASPP28; PAP; PAP1
Locus ID 11333
UniProt ID Q13442
Cytogenetics 7q22.1
Summary The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. [provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:PDAP1 (NM_014891) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402386 PDAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402386 Transient overexpression lysate of PDGFA associated protein 1 (PDAP1) 100 ug
$436.00
TP300058 Recombinant protein of human PDGFA associated protein 1 (PDAP1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720268 Recombinant protein of human PDGFA associated protein 1 (PDAP1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.