PDAP1 (NM_014891) Human Mass Spec Standard

CAT#: PH300058

PDAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055706)

Product Images

Coomassie blue staining of purified PDAP1 protein (Cat# TP300058). The protein was produced from HEK293T cells transfected with PDAP1 cDNA clone (Cat# RC200058) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200058
• Predicted MW: 20.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200058 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDY
  QQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADL
  ARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055706
• RefSeq Size: 2707
• RefSeq ORF: 543
• Synonyms: HASPP28; PAP; PAP1
• Locus ID: 11333
• UniProt ID: Q13442
• Cytogenetics: 7q22.1
• Summary: The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. [provided by RefSeq, Dec 2010]