nonstructural protein NS2A (NC_012532) Virus Tagged ORF Clone

SKU
VC102532
Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2A [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227200.1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
In Stock*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol nonstructural protein NS2A
Synonyms ZIKV_gp1, ZIKV
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102532 represents NCBI reference of YP_009227200 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTCAACTGATCATATGGACCATTTCTCACTGGGCGTCTTGGTCATCCTGCTGATGGTACAGGAAG
GATTGAAAAAAAGAATGACTACTAAAATCATTATGTCTACTTCAATGGCTGTTCTTGTTGTTATGATACT
GGGGGGTTTTTCCATGTCCGATCTTGCTAAGTTGGTAATCTTGATGGGCGCCACATTTGCTGAAATGAAC
ACTGGGGGTGACGTGGCCCACCTCGCACTCGTCGCTGCTTTTAAAGTTCGCCCCGCCCTGCTCGTAAGCT
TCATCTTCAGAGCTAACTGGACTCCTAGAGAATCTATGCTTCTCGCTCTCGCCTCATGCCTCCTGCAAAC
CGCAATTTCTGCCTTGGAAGGAGATCTCATGGTACTTATTAACGGATTTGCCCTCGCCTGGCTTGCTATC
CGCGCGATGGCCGTTCCAAGAACCGATAATATTGCCCTCCCAATCCTCGCCGCCCTTACTCCCCTTGCAC
GGGGTACACTGCTGGTAGCCTGGAGAGCTGGCCTCGCCACTTGTGGGGGAATCATGCTGCTGTCACTGAA
AGGCAAAGGGTCAGTGAAAAAAAATCTGCCATTTGTCATGGCACTTGGACTCACCGCTGTGCGAGTTGTT
GATCCTATCAATGTTGTGGGACTTCTCCTGCTCACGCGATCAGGTAAAAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC102532 representing YP_009227200
Red=Cloning sites Green=Tags

MGSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIMSTSMAVLVVMILGGFSMSDLAKLVILMGATFAEMN
TGGDVAHLALVAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQTAISALEGDLMVLINGFALAWLAI
RAMAVPRTDNIALPILAALTPLARGTLLVAWRAGLATCGGIMLLSLKGKGSVKKNLPFVMALGLTAVRVV
DPINVVGLLLLTRSGKR

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_012532
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_012532.1, YP_009227200
RefSeq ORF 681 bp
MW 24.1 kDa
Write Your Own Review
You're reviewing:nonstructural protein NS2A (NC_012532) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC102527 Myc-DDK-tagged ORF clone of viral ORF for anchored capsid protein C [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227206.1 10 ug
$165.00
VC102528 Myc-DDK-tagged ORF clone of viral ORF for capsid protein C [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227196.1 10 ug
$165.00
VC102529 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein precursor M [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227197.1 10 ug
$289.00 MSRP $330.00 MSRP $330.00
VC102530 Myc-DDK-tagged ORF clone of viral ORF for envelope protein E [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227198.1 10 ug
$746.00
VC102531 Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS1 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227199.1 10 ug
$686.00
VC102533 Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2B [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227201.1 10 ug
$289.00
VC102534 Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS3 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227202.1 10 ug
$289.00 MSRP $633.00 MSRP $633.00
VC102535 Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4A [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227203.1 10 ug
$240.00
VC102536 Myc-DDK-tagged ORF clone of viral ORF for Protein 2K [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227209.1 10 ug
$165.00
VC102537 Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4B [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227204.1 10 ug
$450.00
VC102538 Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS5 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227205.1 10 ug
$589.00 MSRP $910.00 MSRP $910.00
VC102539 Myc-DDK-tagged ORF clone of viral ORF for Membrane glycoprotein M [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227208.1 10 ug
$165.00
VC102540 Myc-DDK-tagged ORF clone of viral ORF for Protein pr [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227207.1 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.