capsid protein (NC_009942) Virus Tagged ORF Clone

SKU
VC102516
Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, YP_001527878
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol capsid protein
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102516 represents NCBI reference of YP_001527878 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGAGCAAAAAACCAGGAGGGCCGGGAAAAAGCCGGGCAGTAAACATGCTGAAACGGGGTATGCCAA
GAGTGTTGTCTCTCATCGGGCTCAAACGGGCCATGCTCTCACTTATTGACGGAAAGGGTCCAATTCGATT
TGTACTGGCACTGCTGGCTTTCTTTAGGTTCACAGCAATCGCTCCCACTCGCGCCGTGCTGGACCGGTGG
CGGGGGGTCAACAAGCAAACAGCCATGAAACATTTGCTCAGCTTTAAGAAAGAACTGGGCACCCTGACAT
CAGCAATTAATCGGCGGTCAAGTAAGCAGAAGAAACGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC102516 representing YP_001527878
Red=Cloning sites Green=Tags

MMSKKPGGPGKSRAVNMLKRGMPRVLSLIGLKRAMLSLIDGKGPIRFVLALLAFFRFTAIAPTRAVLDRW
RGVNKQTAMKHLLSFKKELGTLTSAINRRSSKQKKR

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_009942
ORF Size 318 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_009942.1, YP_001527878
RefSeq ORF 318 bp
MW 11.8 kDa
Write Your Own Review
You're reviewing:capsid protein (NC_009942) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC102517 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, YP_001527879 10 ug
$330.00
VC102518 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, YP_001527880 10 ug
$514.00
VC102519 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, YP_001527881 10 ug
$503.00
VC102520 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, YP_001527882 10 ug
$330.00
VC102521 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, YP_001527883 10 ug
$165.00
VC102522 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, YP_001527884 10 ug
$635.00
VC102523 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, YP_001527885 10 ug
$165.00
VC102524 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, YP_001527886 10 ug
$330.00
VC102526 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, YP_005097850 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.