non-structural protein NS1 (NC_001563) Virus Tagged ORF Clone

SKU
VC102507
Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776015
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$503.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol non-structural protein NS1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102507 represents NCBI reference of NP_776015 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACACAGGGTGCGCGATCGATATCGGGCGACAGGAGCTGCGATGTGGGAGCGGCGTGTTTATCCATA
ACGACGTTGAGGCATGGATGGATAGGTACAAATTCTACCCAGAAACCCCCCAGGGCCTGGCCAAGATCAT
TCAGAAGGCTCACGCCGAAGGAGTGTGCGGTCTGCGGTCCGTCAGCAGGCTTGAACATCAGATGTGGGAA
GCCATAAAGGACGAACTCAATACCCTCCTCAAGGAAAACGGCGTGGATCTTAGCGTCGTGGTCGAGAAAC
AGAATGGCATGTACAAGGCCGCCCCTAAACGATTGGCGGCAACCACTGAGAAATTGGAGATGGGTTGGAA
GGCCTGGGGGAAGTCTATCATCTTCGCACCTGAGCTTGCGAACAACACGTTCGTTATTGACGGCCCAGAG
ACCGAGGAGTGTCCAACAGCAAATAGAGCCTGGAATTCTATGGAGGTAGAGGACTTCGGGTTCGGTCTGA
CATCCACTAGAATGTTTCTGAGGATTCGGGAGACCAACACCACTGAATGTGACTCTAAGATTATCGGCAC
AGCAGTCAAAAACAATATGGCAGTACACAGTGACCTGAGTTACTGGATCGAGAGCGGACTTAACGATACA
TGGAAGCTTGAAAGAGCCGTTCTTGGCGAAGTTAAAAGCTGCACCTGGCCCGAGACCCACACACTCTGGG
GCGATGGGGTTCTCGAGAGCGATCTGATAATCCCAATCACGCTGGCAGGCCCGAGAAGCAATCATAATAG
ACGCCCAGGTTACAAAACTCAAAATCAAGGCCCTTGGGACGAGGGCCGAGTCGAAATTGACTTTGACTAT
TGTCCTGGCACCACCGTGACAATCTCCGACAGTTGCGAGCACCGAGGACCCGCCGCCAGGACCACCACTG
AGTCCGGTAAGCTGATTACTGATTGGTGTTGTCGCTCCTGTACTCTGCCGCCACTTCGATTCCAGACTGA
AAACGGCTGCTGGTATGGCATGGAGATCAGGCCCACAAGACACGACGAAAAGACCCTTGTGCAGTCCAGA
GTTAATGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC102507 representing NP_776015
Red=Cloning sites Green=Tags

MDTGCAIDIGRQELRCGSGVFIHNDVEAWMDRYKFYPETPQGLAKIIQKAHAEGVCGLRSVSRLEHQMWE
AIKDELNTLLKENGVDLSVVVEKQNGMYKAAPKRLAATTEKLEMGWKAWGKSIIFAPELANNTFVIDGPE
TEECPTANRAWNSMEVEDFGFGLTSTRMFLRIRETNTTECDSKIIGTAVKNNMAVHSDLSYWIESGLNDT
WKLERAVLGEVKSCTWPETHTLWGDGVLESDLIIPITLAGPRSNHNRRPGYKTQNQGPWDEGRVEIDFDY
CPGTTVTISDSCEHRGPAARTTTESGKLITDWCCRSCTLPPLRFQTENGCWYGMEIRPTRHDEKTLVQSR
VNA

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001563
ORF Size 1059 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001563.2, NP_776015
RefSeq ORF 1059 bp
MW 39.7 kDa
Write Your Own Review
You're reviewing:non-structural protein NS1 (NC_001563) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC102502 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776010 10 ug
$165.00
VC102503 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776011 10 ug
$225.00
VC102504 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776012 10 ug
$330.00
VC102505 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776013 10 ug
$165.00
VC102506 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776014 10 ug
$503.00
VC102508 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776016 10 ug
$330.00
VC102509 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776017 10 ug
$165.00
VC102510 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776018 10 ug
$635.00
VC102511 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776019 10 ug
$165.00
VC102512 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776020 10 ug
$165.00
VC102513 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776021 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.