Coronavirus IBV nsp3 (HD2) Gene Tagged ORF Clone

SKU
VC102254
Myc-DDK-tagged ORF clone for coronavirus nsp3 (HD2) [Infectious bronchitis virus], codon optimized for human cell expression, NP_740624
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
4 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol coronavirus nsp3 (HD2)
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102254 represents NCBI reference of NP_740624 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCATTCGTCCGGAAAGCAACCTCCTGGTTCTGGTCCCGGTGCGTGCTCGCCTGCTTCCTCTTCG
TTCTGTGCGCCATCGTGCTGTTTACCGCTGTGCCCTTGAAGTTTTACGTATACGCTGCAGTAATCCTTCT
TATGGCTGTGCTCTTCATCAGTTTTACCGTCAAGCACGTAATGGCCTACATGGACACTTTCCTGTTGCCT
ACCCTCATCACTGTGATCATCGGAGTTTGCGCCGAAGTCCCTTTCATCTACAACACACTCATCTCTCAGG
TGGTGATCTTCCTGTCTCAGTGGTATGATCCAGTTGTGTTCGACACCATGGTGCCTTGGATGTTCCTCCC
ATTGGTCCTGTATACCGCTTTTAAATGTGTCCAGGGATGTTATATGAACTCCTTTAATACCTCTTTGCTT
ATGCTCTATCAGTTTGTCAAGCTGGGGTTCGTTATCTACACCAGCTCAAATACGCTCACCGCCTATACAG
AGGGCAACTGGGAGCTGTTCTTCGAGCTCGTCCACACGACTGTACTCGCTAACGTGTCATCTAACTCCCT
GATTGGCCTGTTTGTGTTTAAGTGCGCCAAATGGATGCTGTATTACTGTAACGCCACTTATCTGAACAAT
TACGTCCTCATGGCTGTGATGGTCAACTGCATTGGATGGCTGTGTACTTGTTACTTTGGACTTTACTGGT
GGGTCAATAAGGTGTTTGGCCTTACACTGGGGAAGTATAACTTCAAAGTGTCTGTAGACCAGTATCGGTA
CATGTGCCTGCACAAAATCAACCCCCCGAAGACCGTGTGGGAAGTGTTCAGTACCAACATCTTGATCCAG
GGTATTGGCGGGGACCGGGTCTTGCCAATCGCTACTGTCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC102254 representing NP_740624
Red=Cloning sites Green=Tags

MSSFVRKATSWFWSRCVLACFLFVLCAIVLFTAVPLKFYVYAAVILLMAVLFISFTVKHVMAYMDTFLLP
TLITVIIGVCAEVPFIYNTLISQVVIFLSQWYDPVVFDTMVPWMFLPLVLYTAFKCVQGCYMNSFNTSLL
MLYQFVKLGFVIYTSSNTLTAYTEGNWELFFELVHTTVLANVSSNSLIGLFVFKCAKWMLYYCNATYLNN
YVLMAVMVNCIGWLCTCYFGLYWWVNKVFGLTLGKYNFKVSVDQYRYMCLHKINPPKTVWEVFSTNILIQ
GIGGDRVLPIATVQ

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001451
ORF Size 882 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001451.1, NP_740624
RefSeq ORF 882 bp
MW 33.9 kDa
Write Your Own Review
You're reviewing:Coronavirus IBV nsp3 (HD2) Gene Tagged ORF Clone
Your Rating
SKU Description Size Price
VC102242 Myc-DDK-tagged ORF clone of viral ORF for spike protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040831 10 ug
$1,113.00
VC102243 Myc-DDK-tagged ORF clone of viral ORF for 3a protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040832 10 ug
$165.00
VC102244 Myc-DDK-tagged ORF clone of viral ORF for 3b protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040833 10 ug
$165.00
VC102245 Myc-DDK-tagged ORF clone of viral ORF for small virion-associated protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040834 10 ug
$165.00
VC102246 Myc-DDK-tagged ORF clone of viral ORF for membrane protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040835 10 ug
$330.00
VC102247 Myc-DDK-tagged ORF clone of viral ORF for 5a protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040836 10 ug
$165.00
VC102248 Myc-DDK-tagged ORF clone of viral ORF for 5b protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040837 10 ug
$165.00
VC102249 Myc-DDK-tagged ORF clone of viral ORF for nucleocapsid protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040838 10 ug
$503.00
VC102251 Myc-DDK-tagged ORF clone for coronavirus nsp8 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740621 10 ug
$165.00
VC102253 Myc-DDK-tagged ORF clone for coronavirus nsp2 (3CL-Pro) [Infectious bronchitis virus], codon optimized for human cell expression, NP_740623 10 ug
$289.00 MSRP $330.00 MSRP $330.00
VC102255 Myc-DDK-tagged ORF clone for coronavirus nsp4 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740625 10 ug
$165.00
VC102256 Myc-DDK-tagged ORF clone for coronavirus nsp5 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740626 10 ug
$330.00
VC102257 Myc-DDK-tagged ORF clone for coronavirus nsp6 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740627 10 ug
$165.00
VC102258 Myc-DDK-tagged ORF clone for coronavirus nsp7 (GLF) [Infectious bronchitis virus], codon optimized for human cell expression, NP_740628 10 ug
$165.00
VC102260 Myc-DDK-tagged ORF clone for coronavirus nsp10 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740630 10 ug
$615.00
VC102261 Myc-DDK-tagged ORF clone for coronavirus nsp11 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740631 10 ug
$535.00
VC102262 Myc-DDK-tagged ORF clone for coronavirus nsp12 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740632 10 ug
$503.00
VC102263 Myc-DDK-tagged ORF clone for coronavirus nsp13 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740633 10 ug
$330.00
VC102264 Myc-DDK-tagged ORF clone of viral ORF for leader protein p87 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740634 10 ug
$679.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.