3C mature peptide (NC_001489) Virus Tagged ORF Clone

SKU
VC102190
Myc-DDK-tagged ORF clone of viral ORF for 3C mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740558
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol 3C mature peptide
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102190 represents NCBI reference of NP_740558 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTACTCTCGAGATTGCAGGACTCGTTCGAAAGAATCTGGTACAGTTCGGCGTCGGAGAGAAAAATG
GATGTGTGAGATGGGTCATGAACGCTCTCGGGGTGAAAGATGACTGGCTGCTGGTTCCTTCTCATGCATA
TAAGTTTGAGAAAGACTACGAAATGATGGAATTCTACTTTAACCGCGGGGGCACATACTACAGTATTAGT
GCTGGTAACGTAGTTATTCAGTCACTTGATGTTGGATTTCAAGACGTGGTTCTGATGAAAGTACCCACAA
TTCCAAAGTTCCGGGATATAACTCAGCATTTTATCAAAAAGGGTGATGTCCCCCGGGCTCTCAATAGACT
GGCAACTCTCGTAACCACCGTGAATGGAACGCCCATGCTGATCTCTGAAGGCCCCCTGAAGATGGAAGAG
AAAGCCACATATGTGCACAAGAAGAATGACGGGACGACCGTGGACCTGACTGTCGACCAGGCATGGCGCG
GCAAGGGCGAAGGCCTCCCTGGTATGTGTGGTGGCGCTCTGGTATCTAGTAACCAAAGTATCCAAAATGC
CATCCTGGGCATCCACGTGGCCGGGGGAAACAGTATACTCGTTGCGAAACTGGTTACTCAGGAGATGTTC
CAGAATATTGATAAAAAAATCGAGTCTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC102190 representing NP_740558
Red=Cloning sites Green=Tags

MSTLEIAGLVRKNLVQFGVGEKNGCVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSIS
AGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEE
KATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMF
QNIDKKIESQ

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001489
ORF Size 660 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001489.1, NP_740558
RefSeq ORF 660 bp
MW 24.2 kDa
Write Your Own Review
You're reviewing:3C mature peptide (NC_001489) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC102180 Myc-DDK-tagged ORF clone of viral ORF for 1A VP4a mature peptide (alt) [Hepatitis A virus], codon optimized for human cell expression, NP_740548 10 ug
$165.00
VC102181 Myc-DDK-tagged ORF clone of viral ORF for 1A VP4b mature peptide (alt) [Hepatitis A virus], codon optimized for human cell expression, NP_740549 10 ug
$165.00
VC102182 Myc-DDK-tagged ORF clone of viral ORF for 1B VP2 mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740550 10 ug
$330.00
VC102183 Myc-DDK-tagged ORF clone of viral ORF for 1C VP3 mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740551 10 ug
$480.00
VC102184 Myc-DDK-tagged ORF clone of viral ORF for 1D VP1 mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740552 10 ug
$480.00
VC102185 Myc-DDK-tagged ORF clone of viral ORF for 2A mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740553 10 ug
$330.00
VC102186 Myc-DDK-tagged ORF clone of viral ORF for 2B mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740554 10 ug
$165.00
VC102187 Myc-DDK-tagged ORF clone of viral ORF for 2C mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740555 10 ug
$503.00
VC102188 Myc-DDK-tagged ORF clone of viral ORF for 3A mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740556 10 ug
$165.00
VC102189 Myc-DDK-tagged ORF clone of viral ORF for 3B (VPg) mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740557 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.