protein 3C (NC_010810) Virus Tagged ORF Clone

SKU
VC102176
Myc-DDK-tagged ORF clone of viral ORF for protein 3C [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950231
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol protein 3C
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102176 represents NCBI reference of YP_001950231 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGGTGGGAAAATCGTGGCACAGGCGGGCAACCCAATCATGGACTACGAGGTGAACATCGCCAAGA
ATATGGTCACACCCATCACCTTTTTCTACGCCGATAAGGCCCAGGTGACTCAATCATGTCTGCTCGTCAA
GGGGCACCTGTTTGTTGTCAACCGCCACGTCGCCGAAACAGATTGGTGCGCATTTGAGTTGAGGGGAACC
AGACACGAGCGAGACAGCGTACAAATGCGCTCTATCAATAAAAGCGGGATGGAGGTCGACCTCACCTTTG
TAAAAGTGGTCAAGGGACCTTTGTTTAAAGATAACTCAAGGAAGTTCTGCAGCAAGGACGACGACTTCCC
CGCTAGAAACGAGACTGTTACTGGAATCATGAACACCGGGGTCCCTTTTGTATTTACAGGAAAATTTCTG
GTTGGCAATCAGCCAGTTAACACAACCACAGGAGCCTGCTTTAATCATTGTATTCACTACCGGGCTACTA
CACACAGAGGATGGTGCGGTTCCGCCCTCATATGTCATGTTAATGGAAAGAAGGCAGTCTATGCCATGCA
CAGTGCCGGCGGAGGAGGAATGGCTGCTGCAACCATAATTACCCAGGAAATGATTGAGGCAGCCGAGAAG
GCCCTGGACTGCCTGATCCCACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC102176 representing YP_001950231
Red=Cloning sites Green=Tags

MGGGKIVAQAGNPIMDYEVNIAKNMVTPITFFYADKAQVTQSCLLVKGHLFVVNRHVAETDWCAFELRGT
RHERDSVQMRSINKSGMEVDLTFVKVVKGPLFKDNSRKFCSKDDDFPARNETVTGIMNTGVPFVFTGKFL
VGNQPVNTTTGACFNHCIHYRATTHRGWCGSALICHVNGKKAVYAMHSAGGGGMAAATIITQEMIEAAEK
ALDCLIPQ

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_010810
ORF Size 654 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_010810.1, YP_001950231
RefSeq ORF 654 bp
MW 23.8 kDa
Write Your Own Review
You're reviewing:protein 3C (NC_010810) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC102166 Myc-DDK-tagged ORF clone of viral ORF for leader peptide [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950221 10 ug
$165.00
VC102167 Myc-DDK-tagged ORF clone of viral ORF for capsid protein VP4 [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950222 10 ug
$165.00
VC102168 Myc-DDK-tagged ORF clone of viral ORF for capsid protein VP2 [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950223 10 ug
$330.00
VC102169 Myc-DDK-tagged ORF clone of viral ORF for capsid protein VP3 [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950224 10 ug
$330.00
VC102170 Myc-DDK-tagged ORF clone of viral ORF for capsid protein VP1 [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950225 10 ug
$330.00
VC102171 Myc-DDK-tagged ORF clone of viral ORF for protein 2A [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950226 10 ug
$165.00
VC102172 Myc-DDK-tagged ORF clone of viral ORF for protein 2B [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950227 10 ug
$165.00
VC102173 Myc-DDK-tagged ORF clone of viral ORF for protein 2C [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950228 10 ug
$330.00
VC102174 Myc-DDK-tagged ORF clone of viral ORF for protein 3A [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950229 10 ug
$165.00
VC102175 Myc-DDK-tagged ORF clone of viral ORF for protein 3B [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950230 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.