p24 CA (NC_001436) Virus Tagged ORF Clone

SKU
VC102148
Myc-DDK-tagged ORF clone of viral ORF for p24 CA [Human T-lymphotropic virus 1], codon optimized for human cell expression, NP_955618
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
4 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol p24 CA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102148 represents NCBI reference of NP_955618 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGTGATGCATCCCCATGGAGCCCCCCCTAATCATAGGCCCTGGCAAATGAAGGACCTCCAAGCAA
TAAAACAAGAGGTCTCCCAGGCTGCCCCCGGATCCCCGCAATTCATGCAAACTATTAGACTTGCAGTCCA
GCAGTTCGATCCTACCGCTAAAGACCTCCAAGACCTGCTCCAGTACCTGTGTAGTTCACTGGTTGCGTCC
CTCCATCATCAGCAGCTCGACTCACTGATCAGCGAAGCTGAGACCCGGGGAATTACAGGATACAATCCAC
TTGCCGGGCCGCTGCGGGTGCAGGCAAACAATCCCCAGCAGCAGGGACTGCGGCGCGAGTATCAGCAGCT
GTGGCTTGCGGCCTTTGCCGCACTGCCCGGCTCCGCCAAGGATCCATCATGGGCTTCAATCCTGCAAGGG
CTTGAGGAGCCTTACCACGCCTTCGTAGAGCGATTGAACATTGCACTGGACAATGGGCTGCCTGAAGGAA
CGCCTAAGGACCCAATTCTCCGCAGCCTGGCGTATTCTAATGCTAACAAGGAGTGCCAGAAACTGCTGCA
AGCCCGGGGACATACAAACTCTCCACTTGGCGACATGCTGAGGGCATGCCAGGCTTGGACACCGAAGGAT
AAAACAAAGGTGCTGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC102148 representing NP_955618
Red=Cloning sites Green=Tags

MPVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVAS
LHHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWASILQG
LEEPYHAFVERLNIALDNGLPEGTPKDPILRSLAYSNANKECQKLLQARGHTNSPLGDMLRACQAWTPKD
KTKVLV

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001436
ORF Size 648 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001436.1, NP_955618
RefSeq ORF 648 bp
MW 24.0 kDa
Write Your Own Review
You're reviewing:p24 CA (NC_001436) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC102141 Myc-DDK-tagged ORF clone of viral ORF for Pr55 [Human T-lymphotropic virus 1], codon optimized for human cell expression, NP_057862 10 ug
$503.00
VC102142 Myc-DDK-tagged ORF clone of viral ORF for Pr gag-pro [Human T-lymphotropic virus 1], codon optimized for human cell expression, NP_057861 10 ug
$909.00
VC102144 Myc-DDK-tagged ORF clone of viral ORF for gp46 SU [Human T-lymphotropic virus 1], codon optimized for human cell expression, NP_057865 10 ug
$503.00
VC102145 Myc-DDK-tagged ORF clone of viral ORF for p40 [Human T-lymphotropic virus 1], codon optimized for human cell expression, NP_057864 10 ug
$686.00
VC102146 Myc-DDK-tagged ORF clone of viral ORF for p27 [Human T-lymphotropic virus 1], codon optimized for human cell expression, NP_057863 10 ug
$503.00
VC102147 Myc-DDK-tagged ORF clone of viral ORF for p19 MA [Human T-lymphotropic virus 1], codon optimized for human cell expression, NP_955617 10 ug
$165.00
VC102150 Myc-DDK-tagged ORF clone of viral ORF for gp46 SU [Human T-lymphotropic virus 1], codon optimized for human cell expression, NP_955620 10 ug
$503.00
VC102151 Myc-DDK-tagged ORF clone of viral ORF for p21 TM [Human T-lymphotropic virus 1], codon optimized for human cell expression, NP_955621 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.