1A (VP4) (NC_001490) Virus Tagged ORF Clone

SKU
VC102106
Myc-DDK-tagged ORF clone of viral ORF for 1A (VP4) [Human rhinovirus 14], codon optimized for human cell expression, NP_740515
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol 1A (VP4)
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102106 represents NCBI reference of NP_740515 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGGCGCACAGGTTAGCACCCAGAAGAGCGGCAGTCACGAAAATCAAAATATCCTTACAAACGGGA
GCAATCAGACTTTTACTGTAATCAATTACTACAAGGATGCCGCATCTACTTCTTCAGCCGGCCAAAGTTT
GTCTATGGACCCATCTAAGTTCACAGAACCAGTCAAGGACCTGATGCTGAAAGGCGCCCCAGCACTTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC102106 representing NP_740515
Red=Cloning sites Green=Tags

MMGAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001490
ORF Size 210 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001490.1, NP_740515
RefSeq ORF 210 bp
MW 7.4 kDa
Write Your Own Review
You're reviewing:1A (VP4) (NC_001490) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC102107 Myc-DDK-tagged ORF clone of viral ORF for 1B (VP2) [Human rhinovirus 14], codon optimized for human cell expression, NP_740516 10 ug
$289.00 MSRP $330.00 MSRP $330.00
VC102108 Myc-DDK-tagged ORF clone of viral ORF for 1C (VP3) [Human rhinovirus 14], codon optimized for human cell expression, NP_740517 10 ug
$289.00 MSRP $330.00 MSRP $330.00
VC102109 Myc-DDK-tagged ORF clone of viral ORF for 1D (VP1) [Human rhinovirus 14], codon optimized for human cell expression, NP_740518 10 ug
$450.00
VC102110 Myc-DDK-tagged ORF clone of viral ORF for 2A (P2-A) [Human rhinovirus 14], codon optimized for human cell expression, NP_740519 10 ug
$225.00
VC102111 Myc-DDK-tagged ORF clone of viral ORF for 2B (P2-B) [Human rhinovirus 14], codon optimized for human cell expression, NP_740520 10 ug
$289.00
VC102112 Myc-DDK-tagged ORF clone of viral ORF for 2C (P2-C) [Human rhinovirus 14], codon optimized for human cell expression, NP_740521 10 ug
$289.00 MSRP $300.00 MSRP $300.00
VC102113 Myc-DDK-tagged ORF clone of viral ORF for 3A (P3-A) [Human rhinovirus 14], codon optimized for human cell expression, NP_740522 10 ug
$289.00
VC102114 Myc-DDK-tagged ORF clone of viral ORF for 3B (VPg) [Human rhinovirus 14], codon optimized for human cell expression, NP_740523 10 ug
$165.00
VC102115 Myc-DDK-tagged ORF clone of viral ORF for 3C (protease) [Human rhinovirus 14], codon optimized for human cell expression, NP_740524 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.