P (NC_001781) Virus Tagged ORF Clone

SKU
VC102097
Myc-DDK-tagged ORF clone of viral ORF for P [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056859
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol P Protein
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102097 represents NCBI reference of NP_056859 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAAGTTCGCCCCTGAATTTCATGGAGAAGACGCTAACAACAAGGCAACTAAATTTCTTGAGTCCA
TCAAAGGAAAGTTCGCCTCCAGTAAAGATCCTAAAAAAAAAGACTCCATTATCTCAGTCAATAGTATTGA
TATCGAGGTCACCAAGGAAAGCCCCATCACTAGTGGAACTAACATCATCAACCCGACCTCCGAAGCAGAT
TCAACACCAGAGACGAAGGCAAACTATCCTCGCAAACCCTTGGTGAGCTTTAAAGAGGATCTCACTCCTA
GCGATAATCCTTTCTCAAAGCTCTATAAAGAGACAATCGAGACATTTGATAACAATGAAGAAGAATCCTC
CTACTCCTACGAGGAAATCAACGATCAGACAAATGACAACATTACCGCTCGGCTGGACCGGATAGATGAG
AAACTCTCTGAGATATTGGGCATGCTGCACACCCTCGTCGTCGCGAGTGCAGGTCCCACCTCCGCACGAG
ACGGGATAAGGGATGCAATGGTGGGACTTCGGGAGGAGATGATTGAAAAAATCCGCGCCGAGGCTCTGAT
GACCAACGATAGGTTGGAGGCCATGGCTAGACTGCGCAATGAGGAGAGTGAGAAGATGGCAAAGGATACC
TCCGATGAGGTGCCCCTCAATCCTACAAGTAAAAAACTGTCCGATCTGCTTGAGGACAATGATAGCGATA
ATGACCTGAGTCTCGACGACTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC102097 representing NP_056859
Red=Cloning sites Green=Tags

MEKFAPEFHGEDANNKATKFLESIKGKFASSKDPKKKDSIISVNSIDIEVTKESPITSGTNIINPTSEAD
STPETKANYPRKPLVSFKEDLTPSDNPFSKLYKETIETFDNNEEESSYSYEEINDQTNDNITARLDRIDE
KLSEILGMLHTLVVASAGPTSARDGIRDAMVGLREEMIEKIRAEALMTNDRLEAMARLRNEESEKMAKDT
SDEVPLNPTSKKLSDLLEDNDSDNDLSLDDF

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001781
ORF Size 723 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001781.1, NP_056859
RefSeq ORF 723 bp
Locus ID 1489821
MW 27.0 kDa
Write Your Own Review
You're reviewing:P (NC_001781) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC102094 Myc-DDK-tagged ORF clone of viral ORF for non-structural protein 1 [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056856 10 ug
$225.00
VC102095 Myc-DDK-tagged ORF clone of viral ORF for non-structural protein 2 [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056857 10 ug
$289.00
VC102096 Myc-DDK-tagged ORF clone of viral ORF for N [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056858 10 ug
$686.00
VC102098 Myc-DDK-tagged ORF clone of viral ORF for M [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056860 10 ug
$450.00
VC102099 Myc-DDK-tagged ORF clone of viral ORF for SH [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056861 10 ug
$289.00
VC102100 Myc-DDK-tagged ORF clone of viral ORF for attachment glycoprotein [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056862. Note: ORF is codon optimized 10 ug
$289.00 MSRP $330.00 MSRP $330.00
VC102101 Myc-DDK-tagged ORF clone of viral ORF for fusion protein [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056863 10 ug
$801.00
VC102102 Myc-DDK-tagged ORF clone of viral ORF for matrix protein 2 [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056864 10 ug
$289.00 MSRP $330.00 MSRP $330.00
VC102103 Myc-DDK-tagged ORF clone of viral ORF for matrix protein 2 [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056865 10 ug
$289.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.