3A protein (NC_001897) Virus Tagged ORF Clone

SKU
VC102074
Myc-DDK-tagged ORF clone of viral ORF for 3A protein [Human parechovirus], codon optimized for human cell expression, NP_740734
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol 3A protein
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102074 represents NCBI reference of NP_740734 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCTTGGACGACCTTGATGACGCTGTGAGCTACATAAAGCACAATTATCCAGATGCCATCCCTTACA
TTGACGAGTACCTGAATATAGAAATGTCTACCCTGATCGAGCAGATGGAGGCCTTTATTGAGCCCAAGCC
ATCCGTGTTTAAATGCTTCGCTTCCAGGGTGGGGGATAAGATTAAAGAGGCAAGTAGAGAGGTGGTGAAG
TGGTTCTCTGATAAGCTGAAGAGCATGCTCAATTTCGTGGAACGGAACAAAGCTTGGTTGACAGTAGTTA
GCGCCGTGACTAGTGCTATTGGGATACTGCTGCTGGTGACGAAGATCTTTAAGAAAGAGGAAAGTAAAGA
CGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC102074 representing NP_740734
Red=Cloning sites Green=Tags

MTLDDLDDAVSYIKHNYPDAIPYIDEYLNIEMSTLIEQMEAFIEPKPSVFKCFASRVGDKIKEASREVVK
WFSDKLKSMLNFVERNKAWLTVVSAVTSAIGILLLVTKIFKKEESKDE

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001897
ORF Size 354 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001897.1, NP_740734
RefSeq ORF 354 bp
MW 13.6 kDa
Write Your Own Review
You're reviewing:3A protein (NC_001897) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC102068 Myc-DDK-tagged ORF clone of viral ORF for VP0 protein [Human parechovirus], codon optimized for human cell expression, NP_740384 10 ug
$330.00
VC102069 Myc-DDK-tagged ORF clone of viral ORF for VP3 protein [Human parechovirus], codon optimized for human cell expression, NP_740385 10 ug
$330.00
VC102070 Myc-DDK-tagged ORF clone of viral ORF for VP1 protein [Human parechovirus], codon optimized for human cell expression, NP_740386 10 ug
$330.00
VC102071 Myc-DDK-tagged ORF clone of viral ORF for 2A protein [Human parechovirus], codon optimized for human cell expression, NP_740731 10 ug
$165.00
VC102072 Myc-DDK-tagged ORF clone of viral ORF for 2b protein [Human parechovirus], codon optimized for human cell expression, NP_740732 10 ug
$165.00
VC102073 Myc-DDK-tagged ORF clone of viral ORF for 2C protein [Human parechovirus], codon optimized for human cell expression, NP_740733 10 ug
$330.00
VC102075 Myc-DDK-tagged ORF clone of viral ORF for VPg protein 3B [Human parechovirus], codon optimized for human cell expression, NP_740735 10 ug
$165.00
VC102076 Myc-DDK-tagged ORF clone of viral ORF for proteinase 3C (picornain 3C) [Human parechovirus], codon optimized for human cell expression, NP_740736 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.