E6 (NC_001526) Virus Tagged ORF Clone

SKU
VC101902
Myc-DDK-tagged ORF clone of viral ORF for transforming protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041325
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$225.00
In Stock*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol E6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101902 represents NCBI reference of NP_041325 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACCAGAAACGAACCGCTATGTTTCAGGATCCTCAGGAGAGACCTCGCAAGCTCCCTCAGCTGTGCA
CTGAGCTCCAGACGACCATTCACGATATCATCCTTGAGTGTGTGTATTGTAAACAGCAGCTGCTGAGACG
GGAAGTGTACGATTTCGCTTTCAGGGACCTCTGCATAGTCTACAGGGACGGAAACCCTTACGCCGTGTGC
GACAAATGTCTGAAATTCTACTCCAAAATCTCTGAATATAGGCACTATTGTTACTCACTTTATGGAACAA
CCCTGGAGCAGCAATATAATAAGCCTCTTTGCGACCTGCTGATTCGGTGCATCAATTGCCAGAAACCGCT
CTGTCCAGAGGAGAAGCAGAGGCACCTGGACAAAAAACAGAGGTTTCATAATATACGGGGGCGGTGGACA
GGCAGGTGTATGAGCTGCTGTCGGAGTAGTCGAACAAGAAGGGAGACCCAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101902 representing NP_041325
Red=Cloning sites Green=Tags

MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVC
DKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWT
GRCMSCCRSSRTRRETQL

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001526
ORF Size 474 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001526.2, NP_041325
RefSeq ORF 474 bp
Locus ID 1489078
UniProt ID P03120
MW 19.2 kDa
Write Your Own Review
You're reviewing:E6 (NC_001526) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC101899 Myc-DDK-tagged ORF clone of viral ORF for E1 [Human papillomavirus type 16], codon optimized for human cell expression, NP_041327 10 ug
$289.00 MSRP $664.00 MSRP $664.00
VC101900 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HpV16gp5, partial [Human papillomavirus type 16], codon optimized for human cell expression, NP_041329 10 ug
$289.00
VC101901 Myc-DDK-tagged ORF clone of viral ORF for E5 protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041330 10 ug
$289.00
VC101903 Myc-DDK-tagged ORF clone of viral ORF for transforming protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041326 10 ug
$225.00
VC101904 Myc-DDK-tagged ORF clone of viral ORF for regulatory protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041328 10 ug
$686.00
VC101905 Myc-DDK-tagged ORF clone of viral ORF for minor capsid protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041331 10 ug
$686.00
VC101906 Myc-DDK-tagged ORF clone of viral ORF for major capsid L1 protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041332 10 ug
$741.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.