E4 (NC_014835) Virus Tagged ORF Clone

SKU
VC101894
Myc-DDK-tagged ORF clone of viral ORF for E4, partial [Human papillomavirus type 148], codon optimized for human cell expression, YP_004111313
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol E4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101894 represents NCBI reference of YP_004111313 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

CATATCAAGATCACTCTGTGCCTCCCTCTGCTGCCGGTGCCCCTTGGTCTGCCCCCCACTCTGAAAACAG
ATCCTCCTAGAACCCCCTTTCCCCTTAGAAAACGGTTGGAAAATGCTGATGGCCGCCCAGCTAAGACCCC
ACACGGAAATCGGCCCCCACCTCGAGTCCTGGACTTTGACTTTGACGATGACGGTCCAAACAAAGAAAAT
CTCCCACCAACCGATACAACTCCTGATCAGCATCAGGAGGAAGAGGAACTGCTGTCCGGCCTCAGATCTC
TGCTGAGGAAGTGGGGTCAGGAATTGGACCTTTATCAAGAACGGGTCTTGCACGAAATTAACGATTATAG
ACGCAGATTGGGGATCCAGCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101894 representing YP_004111313
Red=Cloning sites Green=Tags

HIKITLCLPLLPVPLGLPPTLKTDPPRTPFPLRKRLENADGRPAKTPHGNRPPPRVLDFDFDDDGPNKEN
LPPTDTTPDQHQEEEELLSGLRSLLRKWGQELDLYQERVLHEINDYRRRLGIQH

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_014835
ORF Size 372 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_014835.1, YP_004111313
RefSeq ORF 372 bp
Locus ID 10067315
MW 14.3 kDa
Write Your Own Review
You're reviewing:E4 (NC_014835) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC101892 Myc-DDK-tagged ORF clone of viral ORF for E1 [Human papillomavirus type 148], codon optimized for human cell expression, YP_004111311 10 ug
$616.00
VC101893 Myc-DDK-tagged ORF clone of viral ORF for E2 [Human papillomavirus type 148], codon optimized for human cell expression, YP_004111312 10 ug
$503.00
VC101895 Myc-DDK-tagged ORF clone of viral ORF for E6 [Human papillomavirus type 148], codon optimized for human cell expression, YP_004111309 10 ug
$165.00
VC101896 Myc-DDK-tagged ORF clone of viral ORF for E7 [Human papillomavirus type 148], codon optimized for human cell expression, YP_004111310 10 ug
$165.00
VC101897 Myc-DDK-tagged ORF clone of viral ORF for L1 [Human papillomavirus type 148], codon optimized for human cell expression, YP_004111315 10 ug
$524.00
VC101898 Myc-DDK-tagged ORF clone of viral ORF for L2 [Human papillomavirus type 148], codon optimized for human cell expression, YP_004111314 10 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.