ORF69 (NC_009333) Virus Tagged ORF Clone

SKU
VC101707
Myc-DDK-tagged ORF clone of viral ORF for ORF69 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129427
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol ORF69
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101707 represents NCBI reference of YP_001129427 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCAAATCAGTGTCCTCACATATCTCTCTGGCTACCTCTACTGGGAGATCCGGACCTCGCGACATCC
GGCGGTGCCTGAGCAGCCGCCTGCGCTCAGTTCCTCCCGGCGCCCGAAGTGCCAGCGTTTCCTCAAAACA
CCGCAACGGATTGCGCAAATTTATCAGTGATAAAGTTTTTTTTAGCATTCTGTCCCACCGGCATGAGCTC
GGAGTGGATTTTCTGAGAGAAATGGAAACACCAATCTGTACGAGCAAGACTGTGATGCTTCCATTGGACC
TGAGCACAGTGGCCCCGGGAAGATGCGTATCACTCAGCCCCTTCGGCCATAGCTCCAATATGGGCTTTCA
GTGCGCGCTGTGCCCCAGCACCGAGAACCCTACTGTGGCTCAGGGGAGCAGACCGCAGACAATGGTGGGA
GACGCCCTTAAGAAAAACAACGAGCTGTGTTCTGTCGCCCTGGCCTTCTATCATCATGCGGACAAAGTGA
TACAACACAAGACCTTTTATCTGTCACTGTTGAGTCACTCCATGGATGTAGTGCGACAGTCCTTCCTGCA
GCCTGGACTGCTCTATGCCAACCTTGTTCTCAAAACTTTTGGCCATGATCCCCTCCCTATTTTTACTACT
AACAATGGAATGTTGACTATGTGTATCTTGTTCAAGACTCGAGCCCTCCACCTCGGAGAAACTGCTCTGA
GACTGCTCATGGACAACCTCCCAAACTACAAGATCTCAGCCGACTGCTGTAGACAGTCTTACGTTGTGAA
ATTCGTGCCAACACACCCTGATACTGCCAGCATTGCAGTGCAGGTGCACACGATCTGTGAAGCAGTGGCC
GCCCTCGATTGTACAGACGAAATGAGAGACGACATCCAGAAGGGTACTGCTCTGGTGAACGCTTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101707 representing YP_001129427
Red=Cloning sites Green=Tags

MPKSVSSHISLATSTGRSGPRDIRRCLSSRLRSVPPGARSASVSSKHRNGLRKFISDKVFFSILSHRHEL
GVDFLREMETPICTSKTVMLPLDLSTVAPGRCVSLSPFGHSSNMGFQCALCPSTENPTVAQGSRPQTMVG
DALKKNNELCSVALAFYHHADKVIQHKTFYLSLLSHSMDVVRQSFLQPGLLYANLVLKTFGHDPLPIFTT
NNGMLTMCILFKTRALHLGETALRLLMDNLPNYKISADCCRQSYVVKFVPTHPDTASIAVQVHTICEAVA
ALDCTDEMRDDIQKGTALVNAL

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_009333
ORF Size 906 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_009333.1, YP_001129427
RefSeq ORF 906 bp
Locus ID 4961444
UniProt ID Q2HR82
MW 33.2 kDa
Write Your Own Review
You're reviewing:ORF69 (NC_009333) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC101630 Myc-DDK-tagged ORF clone of viral ORF for K1 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129350 10 ug
$330.00
VC101631 Myc-DDK-tagged ORF clone of viral ORF for KCP [Human herpesvirus 8], codon optimized for human cell expression, YP_001129351 10 ug
$563.00
VC101632 Myc-DDK-tagged ORF clone of viral ORF for ORF6 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129352 10 ug
$1,084.00
VC101633 Myc-DDK-tagged ORF clone of viral ORF for ORF7 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129353 10 ug
$700.00
VC101634 Myc-DDK-tagged ORF clone of viral ORF for ORF8 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129354 10 ug
$851.00
VC101635 Myc-DDK-tagged ORF clone of viral ORF for ORF9 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129355 10 ug
$969.00
VC101636 Myc-DDK-tagged ORF clone of viral ORF for ORF10 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129356 10 ug
$503.00
VC101637 Myc-DDK-tagged ORF clone of viral ORF for ORF11 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129357 10 ug
$503.00
VC101638 Myc-DDK-tagged ORF clone of viral ORF for K2 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129358 10 ug
$450.00
VC101639 Myc-DDK-tagged ORF clone of viral ORF for ORF2 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129359 10 ug
$330.00
VC101640 Myc-DDK-tagged ORF clone of viral ORF for K3 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129360 10 ug
$330.00
VC101641 Myc-DDK-tagged ORF clone of viral ORF for ORF70 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129361 10 ug
$503.00
VC101642 Myc-DDK-tagged ORF clone of viral ORF for K4 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129362 10 ug
$165.00
VC101643 Myc-DDK-tagged ORF clone of viral ORF for K41 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129363 10 ug
$165.00
VC101644 Myc-DDK-tagged ORF clone of viral ORF for K42 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129364 10 ug
$330.00
VC101645 Myc-DDK-tagged ORF clone of viral ORF for K5 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129365 10 ug
$330.00
VC101646 Myc-DDK-tagged ORF clone of viral ORF for K6 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129366 10 ug
$165.00
VC101647 Myc-DDK-tagged ORF clone of viral ORF for K7 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129367 10 ug
$165.00
VC101648 Myc-DDK-tagged ORF clone of viral ORF for ORF16 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129368 10 ug
$330.00
VC101649 Myc-DDK-tagged ORF clone of viral ORF for ORF17 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129369 10 ug
$547.00
VC101650 Myc-DDK-tagged ORF clone of viral ORF for ORF175 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129370 10 ug
$330.00
VC101651 Myc-DDK-tagged ORF clone of viral ORF for ORF18 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129371 10 ug
$330.00
VC101652 Myc-DDK-tagged ORF clone of viral ORF for ORF19 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129372 10 ug
$562.00
VC101653 Myc-DDK-tagged ORF clone of viral ORF for ORF20 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129373 10 ug
$330.00
VC101654 Myc-DDK-tagged ORF clone of viral ORF for ORF21 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129374 10 ug
$594.00
VC101655 Myc-DDK-tagged ORF clone of viral ORF for ORF22 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129375 10 ug
$735.00
VC101656 Myc-DDK-tagged ORF clone of viral ORF for ORF23 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129376 10 ug
$503.00
VC101657 Myc-DDK-tagged ORF clone of viral ORF for ORF24 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129377 10 ug
$757.00
VC101658 Myc-DDK-tagged ORF clone of viral ORF for ORF25 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129378 10 ug
$1,295.00
VC101659 Myc-DDK-tagged ORF clone of viral ORF for ORF26 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129379 10 ug
$330.00
VC101660 Myc-DDK-tagged ORF clone of viral ORF for ORF27 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129380 10 ug
$330.00
VC101661 Myc-DDK-tagged ORF clone of viral ORF for ORF28 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129381 10 ug
$165.00
VC101662 Myc-DDK-tagged ORF clone of viral ORF for ORF29 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129382 10 ug
$692.00
VC101663 Myc-DDK-tagged ORF clone of viral ORF for ORF30 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129383 10 ug
$165.00
VC101664 Myc-DDK-tagged ORF clone of viral ORF for ORF31 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129384 10 ug
$330.00
VC101665 Myc-DDK-tagged ORF clone of viral ORF for ORF32 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129385 10 ug
$503.00
VC101666 Myc-DDK-tagged ORF clone of viral ORF for ORF33 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129386 10 ug
$503.00
VC101667 Myc-DDK-tagged ORF clone of viral ORF for ORF34 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129387 10 ug
$330.00
VC101668 Myc-DDK-tagged ORF clone of viral ORF for ORF35 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129388 10 ug
$165.00
VC101669 Myc-DDK-tagged ORF clone of viral ORF for ORF36 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129389 10 ug
$503.00
VC101670 Myc-DDK-tagged ORF clone of viral ORF for ORF37 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129390 10 ug
$503.00
VC101671 Myc-DDK-tagged ORF clone of viral ORF for ORF38 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129391 10 ug
$165.00
VC101672 Myc-DDK-tagged ORF clone of viral ORF for ORF39 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129392 10 ug
$503.00
VC101673 Myc-DDK-tagged ORF clone of viral ORF for ORF40 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129393 10 ug
$674.00
VC101674 Myc-DDK-tagged ORF clone of viral ORF for ORF42 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129394 10 ug
$330.00
VC101675 Myc-DDK-tagged ORF clone of viral ORF for ORF43 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129395 10 ug
$619.00
VC101676 Myc-DDK-tagged ORF clone of viral ORF for ORF44 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129396 10 ug
$794.00
VC101677 Myc-DDK-tagged ORF clone of viral ORF for ORF45 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129397 10 ug
$503.00
VC101678 Myc-DDK-tagged ORF clone of viral ORF for ORF46 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129398 10 ug
$330.00
VC101679 Myc-DDK-tagged ORF clone of viral ORF for ORF47 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129399 10 ug
$330.00
VC101680 Myc-DDK-tagged ORF clone of viral ORF for ORF48 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129400 10 ug
$503.00
VC101681 Myc-DDK-tagged ORF clone of viral ORF for ORF50 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129401 10 ug
$696.00
VC101682 Myc-DDK-tagged ORF clone of viral ORF for ORF49 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129402 10 ug
$330.00
VC101683 Myc-DDK-tagged ORF clone of viral ORF for K8 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129403 10 ug
$330.00
VC101684 Myc-DDK-tagged ORF clone of viral ORF for K81 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129404 10 ug
$330.00
VC101685 Myc-DDK-tagged ORF clone of viral ORF for ORF52 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129405 10 ug
$165.00
VC101686 Myc-DDK-tagged ORF clone of viral ORF for ORF53 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129406 10 ug
$165.00
VC101687 Myc-DDK-tagged ORF clone of viral ORF for ORF54 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129407 10 ug
$330.00
VC101688 Myc-DDK-tagged ORF clone of viral ORF for ORF55 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129408 10 ug
$330.00
VC101689 Myc-DDK-tagged ORF clone of viral ORF for ORF56 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129409 10 ug
$849.00
VC101690 Myc-DDK-tagged ORF clone of viral ORF for ORF57 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129410 10 ug
$503.00
VC101691 Myc-DDK-tagged ORF clone of viral ORF for K9 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129411 10 ug
$289.00 MSRP $457.00 MSRP $457.00
VC101692 Myc-DDK-tagged ORF clone of viral ORF for vIRF-4 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129412 10 ug
$917.00
VC101693 Myc-DDK-tagged ORF clone of viral ORF for vIRF-3 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129413 10 ug
$580.00
VC101695 Myc-DDK-tagged ORF clone of viral ORF for ORF58 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129415 10 ug
$503.00
VC101696 Myc-DDK-tagged ORF clone of viral ORF for ORF59 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129416 10 ug
$503.00
VC101697 Myc-DDK-tagged ORF clone of viral ORF for ORF60 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129417 10 ug
$330.00
VC101698 Myc-DDK-tagged ORF clone of viral ORF for ORF61 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129418 10 ug
$798.00
VC101699 Myc-DDK-tagged ORF clone of viral ORF for ORF62 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129419 10 ug
$330.00
VC101700 Myc-DDK-tagged ORF clone of viral ORF for ORF63 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129420 10 ug
$935.00
VC101702 Myc-DDK-tagged ORF clone of viral ORF for ORF65 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129422 10 ug
$330.00
VC101703 Myc-DDK-tagged ORF clone of viral ORF for ORF66 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129423 10 ug
$503.00
VC101704 Myc-DDK-tagged ORF clone of viral ORF for ORF67 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129424 10 ug
$330.00
VC101705 Myc-DDK-tagged ORF clone of viral ORF for ORF67A [Human herpesvirus 8], codon optimized for human cell expression, YP_001129425 10 ug
$165.00
VC101706 Myc-DDK-tagged ORF clone of viral ORF for ORF68 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129426 10 ug
$503.00
VC101708 Myc-DDK-tagged ORF clone of viral ORF for K12 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129428 10 ug
$165.00
VC101709 Myc-DDK-tagged ORF clone of viral ORF for K13 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129429 10 ug
$330.00
VC101710 Myc-DDK-tagged ORF clone of viral ORF for ORF72 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129430 10 ug
$330.00
VC101712 Myc-DDK-tagged ORF clone of viral ORF for K14 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129432 10 ug
$330.00
VC101713 Myc-DDK-tagged ORF clone of viral ORF for ORF74 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129433 10 ug
$686.00
VC101714 Myc-DDK-tagged ORF clone of viral ORF for ORF75 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129434 10 ug
$1,241.00
VC101715 Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129435 10 ug
$503.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.