U8 (NC_000898) Virus Tagged ORF Clone

SKU
VC101451
Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp012 [Human herpesvirus 6], codon optimized for human cell expression, NP_050189
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$503.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol U8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101451 represents NCBI reference of NP_050189 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGACGGAAAGCGTGTGAAAGTAAACGGGGTCTTAAATTTAACAAGGTGTGTCACACTACACTCTTTT
TCCCGATAAGCTGCCACGTGACTGCAAGTAGGATCGAGGTTCTGTACTTCCGGTACTTCATCGTATCACT
GCTGGTCCTGTTTGGAGTATTTAAGATGGACCTGGAGGCTAAAGAAGTGAGCGGGGAAATTCCTAACGAA
AACGCCCTCGCCGAACTCTGTAGGTTCTGTGAATCCGCAGATCTGAGTCGAATCGAAAACTTTGTCGGAA
CATACAAAAATTGGTGTCTGTCCATCATCTGGCCCCGCAACTGTTGGCTTCGCTTCACCCTGCGAAAGGA
TGTCGCAGGCTATACTGAAAAAATGTTTGAGGACATGAATGATCACTACCAGGGATTTGTCGAGAAGCTT
TGTCTCTTGGGAACCATTCAGATTCCCTATCGCGATGTCCCGATCTTGATCGGGAGATCCAAAAGAATTT
TCTTGCATGACCTTGAGACCGACACCCTCCACTTCGTCTGCGATAACTTCGAGCAGTTTGTCCGCTATGG
GGTTCTGGGCACCAACATCATCACTTGTGCCGAACCTGTGTACCGACACGGTCTTTATGATGGCCCCCGG
TTCGAGTCTTTGGAAAACTTGCGCAATAACGACGTCCTGCGATCACCCTGCACACTTAACATCCACCTGA
AGCTCAACAGAAAAGGTGTGCTGGGAATTAAAGCCATGAGGAAGCATTACATTGCGATGCTGAGAGAGTT
CGACGAACTCGCCAGGTGCGCCAGTCTTGACGACGTCGAAAGATTTGTATCTCTGAACGTGGGAAGAGAC
CTGCGCCTTGATATGCCAGTGTTCAAGAGTCTGACGTTGGGTACCCGGGACTCAGTGTGGATTGGCACAT
GCAGACTGGCCAATCTCGAGGAGCAGGAAGATCTGGTTGAGAAAGTAGTGGTTCTGGGGTATCTTAACGA
TCACGACTACGAGAGCAAGTGCACAAGGCCTATCCTGTGTATTGGGAAGAGCGGTAAGATATATTATTAC
GATTGGATTGATAATGTCCTGGTGAAACTGGGGGATTGCCTCCTGACCTTCCTGAGAGTTGGGTTTGCCC
GCCTTTTTGCCGACTGTGGATATGAGAAAATCGGTAAAATTTCAATGCGATTTGGGAGAATGTCAACCTT
GGGAATGAGTGAAACCTACCAATCCTGCATGTCCCTCTCTAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101451 representing NP_050189
Red=Cloning sites Green=Tags

MRRKACESKRGLKFNKVCHTTLFFPISCHVTASRIEVLYFRYFIVSLLVLFGVFKMDLEAKEVSGEIPNE
NALAELCRFCESADLSRIENFVGTYKNWCLSIIWPRNCWLRFTLRKDVAGYTEKMFEDMNDHYQGFVEKL
CLLGTIQIPYRDVPILIGRSKRIFLHDLETDTLHFVCDNFEQFVRYGVLGTNIITCAEPVYRHGLYDGPR
FESLENLRNNDVLRSPCTLNIHLKLNRKGVLGIKAMRKHYIAMLREFDELARCASLDDVERFVSLNVGRD
LRLDMPVFKSLTLGTRDSVWIGTCRLANLEEQEDLVEKVVVLGYLNDHDYESKCTRPILCIGKSGKIYYY
DWIDNVLVKLGDCLLTFLRVGFARLFADCGYEKIGKISMRFGRMSTLGMSETYQSCMSLSK

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_000898
ORF Size 1233 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_000898.1, NP_050189
RefSeq ORF 1233 bp
Locus ID 1497020
MW 47.6 kDa
Write Your Own Review
You're reviewing:U8 (NC_000898) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC101440 Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase II [Human herpesvirus 6], codon optimized for human cell expression, NP_050176 10 ug
$764.00
VC101441 Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050180 10 ug
$503.00
VC101442 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp004 [Human herpesvirus 6], codon optimized for human cell expression, NP_050179 10 ug
$165.00
VC101443 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp003 [Human herpesvirus 6], codon optimized for human cell expression, NP_050178 10 ug
$165.00
VC101444 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp002 [Human herpesvirus 6], codon optimized for human cell expression, NP_050177 10 ug
$330.00
VC101445 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp006 [Human herpesvirus 6], codon optimized for human cell expression, NP_050181 10 ug
$165.00
VC101447 Myc-DDK-tagged ORF clone of viral ORF for membrane protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050183 10 ug
$165.00
VC101448 Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050185 10 ug
$503.00
VC101449 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp009 [Human herpesvirus 6], codon optimized for human cell expression, NP_050186 10 ug
$548.00
VC101450 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp014 [Human herpesvirus 6], codon optimized for human cell expression, NP_050188 10 ug
$165.00
VC101452 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp015 [Human herpesvirus 6], codon optimized for human cell expression, NP_050190 10 ug
$165.00
VC101453 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp016 [Human herpesvirus 6], codon optimized for human cell expression, NP_050191 10 ug
$515.00
VC101454 Myc-DDK-tagged ORF clone of viral ORF for antigenic virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050192 10 ug
$1,178.00
VC101455 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp019 [Human herpesvirus 6], codon optimized for human cell expression, NP_050194 10 ug
$165.00
VC101456 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp020 [Human herpesvirus 6], codon optimized for human cell expression, NP_050195 10 ug
$625.00
VC101457 Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein 6 [Human herpesvirus 6], codon optimized for human cell expression, NP_050198 10 ug
$330.00
VC101458 Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein 4 [Human herpesvirus 6], codon optimized for human cell expression, NP_050199 10 ug
$503.00
VC101459 Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050200 10 ug
$503.00
VC101460 Myc-DDK-tagged ORF clone of viral ORF for putative membrane glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050201 10 ug
$503.00
VC101461 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp013 [Human herpesvirus 6], codon optimized for human cell expression, NP_050187 10 ug
$909.00
VC101462 Myc-DDK-tagged ORF clone of viral ORF for transcription regulator [Human herpesvirus 6], codon optimized for human cell expression, NP_050197 10 ug
$503.00
VC101463 Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050202 10 ug
$330.00
VC101464 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp027 [Human herpesvirus 6], codon optimized for human cell expression, NP_050204 10 ug
$289.00
VC101465 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp026 [Human herpesvirus 6], codon optimized for human cell expression, NP_050205 10 ug
$165.00
VC101466 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp025 [Human herpesvirus 6], codon optimized for human cell expression, NP_050206 10 ug
$330.00
VC101467 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp033 [Human herpesvirus 6], codon optimized for human cell expression, NP_050207 10 ug
$330.00
VC101468 Myc-DDK-tagged ORF clone of viral ORF for Polymerase processivity factor [Human herpesvirus 6], codon optimized for human cell expression, NP_050208 10 ug
$503.00
VC101469 Myc-DDK-tagged ORF clone of viral ORF for large ribonuclease reductase [Human herpesvirus 6], codon optimized for human cell expression, NP_050209 10 ug
$810.00
VC101470 Myc-DDK-tagged ORF clone of viral ORF for capsid assembly and DNA maturation [Human herpesvirus 6], codon optimized for human cell expression, NP_050210 10 ug
$330.00
VC101471 Myc-DDK-tagged ORF clone of viral ORF for capsid assembly protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050211 10 ug
$1,036.00
VC101473 Myc-DDK-tagged ORF clone of viral ORF for putative capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050213 10 ug
$165.00
VC101474 Myc-DDK-tagged ORF clone of viral ORF for capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050214 10 ug
$503.00
VC101475 Myc-DDK-tagged ORF clone of viral ORF for putative virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050215 10 ug
$330.00
VC101476 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp038 [Human herpesvirus 6], codon optimized for human cell expression, NP_050216 10 ug
$165.00
VC101477 Myc-DDK-tagged ORF clone of viral ORF for virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050217 10 ug
$503.00
VC101478 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp043 [Human herpesvirus 6], codon optimized for human cell expression, NP_050218 10 ug
$330.00
VC101479 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase [Human herpesvirus 6], codon optimized for human cell expression, NP_050219 10 ug
$969.00
VC101480 Myc-DDK-tagged ORF clone of viral ORF for Glycoprotein B [Human herpesvirus 6], codon optimized for human cell expression, NP_050220 10 ug
$836.00
VC101481 Myc-DDK-tagged ORF clone of viral ORF for transport/capsid assembly [Human herpesvirus 6], codon optimized for human cell expression, NP_050221 10 ug
$731.00
VC101482 Myc-DDK-tagged ORF clone of viral ORF for major DNA binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050222 10 ug
$1,084.00
VC101483 Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050223 10 ug
$528.00
VC101484 Myc-DDK-tagged ORF clone of viral ORF for helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050224 10 ug
$866.00
VC101485 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp050 [Human herpesvirus 6], codon optimized for human cell expression, NP_050225 10 ug
$330.00
VC101486 Myc-DDK-tagged ORF clone of viral ORF for putative dUTPase [Human herpesvirus 6], codon optimized for human cell expression, NP_050226 10 ug
$503.00
VC101487 Myc-DDK-tagged ORF clone of viral ORF for putative membrane /secreted protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050227 10 ug
$165.00
VC101488 Myc-DDK-tagged ORF clone of viral ORF for glycoprotein O [Human herpesvirus 6], codon optimized for human cell expression, NP_050228 10 ug
$743.00
VC101489 Myc-DDK-tagged ORF clone of viral ORF for glycoprotein H [Human herpesvirus 6], codon optimized for human cell expression, NP_050229 10 ug
$699.00
VC101490 Myc-DDK-tagged ORF clone of viral ORF for putative fusion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050230 10 ug
$330.00
VC101491 Myc-DDK-tagged ORF clone of viral ORF for viron protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050231 10 ug
$568.00
VC101492 Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor [Human herpesvirus 6], codon optimized for human cell expression, NP_050232 10 ug
$330.00
VC101493 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp058 [Human herpesvirus 6], codon optimized for human cell expression, NP_050233 10 ug
$330.00
VC101494 Myc-DDK-tagged ORF clone of viral ORF for proteinase [Human herpesvirus 6], codon optimized for human cell expression, NP_050234 10 ug
$541.00
VC101495 Myc-DDK-tagged ORF clone of viral ORF for virion transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050235 10 ug
$503.00
VC101496 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp062 [Human herpesvirus 6], codon optimized for human cell expression, NP_050236 10 ug
$503.00
VC101497 Myc-DDK-tagged ORF clone of viral ORF for capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050237 10 ug
$330.00
VC101498 Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050238 10 ug
$1,265.00
VC101499 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp064 [Human herpesvirus 6], codon optimized for human cell expression, NP_050239 10 ug
$778.00
VC101500 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp065 [Human herpesvirus 6], codon optimized for human cell expression, NP_050240 10 ug
$503.00
VC101501 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp067 [Human herpesvirus 6], codon optimized for human cell expression, NP_050242 10 ug
$165.00
VC101502 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp068 [Human herpesvirus 6], codon optimized for human cell expression, NP_050243 10 ug
$330.00
VC101503 Myc-DDK-tagged ORF clone of viral ORF for tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050244 10 ug
$503.00
VC101504 Myc-DDK-tagged ORF clone of viral ORF for tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050245 10 ug
$503.00
VC101505 Myc-DDK-tagged ORF clone of viral ORF for Putative terminase [Human herpesvirus 6], codon optimized for human cell expression, NP_050241 10 ug
$682.00
VC101506 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp071 [Human herpesvirus 6], codon optimized for human cell expression, NP_050246 10 ug
$503.00
VC101507 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp072 [Human herpesvirus 6], codon optimized for human cell expression, NP_050247 10 ug
$165.00
VC101508 Myc-DDK-tagged ORF clone of viral ORF for Phosphotransferase [Human herpesvirus 6], codon optimized for human cell expression, NP_050248 10 ug
$576.00
VC101509 Myc-DDK-tagged ORF clone of viral ORF for Alkaline exonuclease [Human herpesvirus 6], codon optimized for human cell expression, NP_050249 10 ug
$503.00
VC101510 Myc-DDK-tagged ORF clone of viral ORF for Myristylated virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050250 10 ug
$165.00
VC101511 Myc-DDK-tagged ORF clone of viral ORF for glycoprotein M [Human herpesvirus 6], codon optimized for human cell expression, NP_050251 10 ug
$503.00
VC101512 Myc-DDK-tagged ORF clone of viral ORF for origin binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050252 10 ug
$786.00
VC101513 Myc-DDK-tagged ORF clone of viral ORF for helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050253 10 ug
$678.00
VC101514 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp080 [Human herpesvirus 6], codon optimized for human cell expression, NP_050254 10 ug
$330.00
VC101515 Myc-DDK-tagged ORF clone of viral ORF for putative viron protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050255 10 ug
$678.00
VC101516 Myc-DDK-tagged ORF clone of viral ORF for Helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050256 10 ug
$830.00
VC101517 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp082 [Human herpesvirus 6], codon optimized for human cell expression, NP_050257 10 ug
$165.00
VC101518 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp083 [Human herpesvirus 6], codon optimized for human cell expression, NP_050258 10 ug
$165.00
VC101519 Myc-DDK-tagged ORF clone of viral ORF for DNA replication [Human herpesvirus 6], codon optimized for human cell expression, NP_050259 10 ug
$503.00
VC101520 Myc-DDK-tagged ORF clone of viral ORF for Uracyl-DNA glycosylase [Human herpesvirus 6], codon optimized for human cell expression, NP_050260 10 ug
$330.00
VC101521 Myc-DDK-tagged ORF clone of viral ORF for Glycoprotein L [Human herpesvirus 6], codon optimized for human cell expression, NP_050261 10 ug
$330.00
VC101522 Myc-DDK-tagged ORF clone of viral ORF for Intercrine cytokine [Human herpesvirus 6], codon optimized for human cell expression, NP_050262 10 ug
$165.00
VC101523 Myc-DDK-tagged ORF clone of viral ORF for putative glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050263 10 ug
$503.00
VC101524 Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050264 10 ug
$330.00
VC101526 Myc-DDK-tagged ORF clone of viral ORF for IE-A transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050266 10 ug
$1,032.00
VC101527 Myc-DDK-tagged ORF clone of viral ORF for probable membrane glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050267 10 ug
$165.00
VC101529 Myc-DDK-tagged ORF clone of viral ORF for Parvovirus rep homolog [Human herpesvirus 6], codon optimized for human cell expression, NP_050269 10 ug
$289.00 MSRP $503.00 MSRP $503.00
VC101530 Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein IE2 [Human herpesvirus 6], codon optimized for human cell expression, NP_050270 10 ug
$1,160.00
VC101531 Myc-DDK-tagged ORF clone of viral ORF for spliced envelope glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050271 10 ug
$631.00
VC101533 Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase [Human herpesvirus 6], codon optimized for human cell expression, NP_050273 10 ug
$764.00
VC101534 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp099 [Human herpesvirus 6], codon optimized for human cell expression, NP_050274 10 ug
$330.00
VC101535 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp100 [Human herpesvirus 6], codon optimized for human cell expression, NP_050275 10 ug
$165.00
VC101536 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp101 [Human herpesvirus 6], codon optimized for human cell expression, NP_050276 10 ug
$165.00
VC101537 Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050277 10 ug
$503.00
VC101538 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp103 [Human herpesvirus 6], codon optimized for human cell expression, NP_050278 10 ug
$165.00
VC101539 Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050203 10 ug
$330.00
VC101540 Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp021 [Human herpesvirus 6], codon optimized for human cell expression, NP_050196 10 ug
$330.00
VC101541 Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor [Human herpesvirus 6], codon optimized for human cell expression, NP_050193 10 ug
$330.00
VC101542 Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050184 10 ug
$503.00
VC101543 Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor fragment [Human herpesvirus 6], codon optimized for human cell expression, NP_597817 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.