U53 (NC_001664) Virus Tagged ORF Clone

SKU
VC101402
Myc-DDK-tagged ORF clone of viral ORF for capsid maturation protease [Human herpesvirus 6], codon optimized for human cell expression, NP_042946
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$541.00
4 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol U53
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101402 represents NCBI reference of NP_042946 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAAAAGTGTGGGTGGGTGGCTTCCTGTGCGTCTATGGTGAGGAGCCATCCGAAGAGTGCTTGGCTC
TCCCACGCGATACCGTGCAGAAAGAGCTCGGAAGCGGAAATATACCTCTGCCACTCAATATTAATCACAA
CGAGAAAGCAACAATCGGCATGGTTCGCGGATTGTTCGACTTGGAGCATGGTCTCTTCTGTGTGGCCCAG
ATCCAGTCTCAGACCTTTATGGACATTATTCGAAACATCGCAGGCAAGTCAAAGCTGATCACAGCCGGCT
CTGTAATAGAACCTCTGCCACCCGACCCAGAAATCGAGTGTCTCTCATCATCTTTCCCCGGCTTGTCCCT
CTCCTCCAAGGTGCTCCAGGATGAAAACCTGGATGGTAAACCCTTCTTCCACCATGTAAGTGTGTGTGGT
GTGGGGCGCCGCCCTGGGACGATTGCCATCTTCGGCCGGGAAATCAGCTGGATTCTGGATAGATTCAGCT
GTATTAGCGAGAGCGAAAAGCGACAGGTACTCGAGGGTGTGAATGTGTACTCTCAAGGGTTCGACGAGAA
CTTGTTCTCCGCGGACCTGTATGACCTGTTGGCCGACTCTCTGGACACCTCCTACATCCGAAAAAGGTTC
CCGAAGCTCCAGCTCGATAAGCAGCTCTGCGGTCTGTCAAAGTGCACATATATTAAGGCGTCTGAGCCCC
CGGTCGAAATTATTGTGGCAGCGACCAAAGTCGCGGGCGATCAAGTCCAGCTCACGACTGAACCTGGAAG
CGAGCTGGCTGTCGAGACCTGCGACGTTCCCGTTGTACACGGTAACTACGATGCAGTCGAAAGCGCCACA
GCTACAACCGCAATGAGTAACCAAAACCTGCCTAATACAACCCCACTCCTGTCCTCACCACCGTTTAGCG
ATTGTGTGTTCCTTCCTAAGGATGCCTTCTTTAGTCTGCTGAATGTGACAACTGGGCAGCAGCCCAAGAT
CGTTCCTCCAGTGAGCGTGCACCCACCTGTGACAGAGCAGTATCAGATGCTTCCATACTCCGAAAGTGCA
GCAAAGATCGCCGAGCACGAAAGCAACCGGTACCATTCTCCGTGTCAGGCCATGTACCCTTACTGGCAGT
ATAGCCCAGTCCCACAGTATCCCGCAGCCCTGCACGGATACCGCCAATCTAAGACACTCAAAAAACGCCA
CTTCCAGTCAGACTCCGAGGACGAGCTGAGTTTCCCAGGGGATCCAGAGTACACGAAAAAGAGGCGACGC
CACCGCGTCGATAACGACGACGATAAAGAAATGGCTCGGGAGAAAAACGATCTTAGGGAACTTGTCGATA
TGATCGGAATGTTGAGACAAGAGATTAGTGCCCTGAAACACGTCCGCGCGCAATCACCCCAGCGGCATAT
CGTGCCAATGGAGACTCTGCCAACAATAGAGGAGAAGGGCGCAGCTAGTCCAAAGCCTTCTATACTCAAC
GCTTCACTGGCCCCAGAAACCGTAAATAGGTCACTGGCAGGCCAAAATGAGAGTACAGACCTCCTGAAGC
TGAACAAGAAGTTGTTTGTAGACGCCCTTAACAAGATGGATTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101402 representing NP_042946
Red=Cloning sites Green=Tags

MSKVWVGGFLCVYGEEPSEECLALPRDTVQKELGSGNIPLPLNINHNEKATIGMVRGLFDLEHGLFCVAQ
IQSQTFMDIIRNIAGKSKLITAGSVIEPLPPDPEIECLSSSFPGLSLSSKVLQDENLDGKPFFHHVSVCG
VGRRPGTIAIFGREISWILDRFSCISESEKRQVLEGVNVYSQGFDENLFSADLYDLLADSLDTSYIRKRF
PKLQLDKQLCGLSKCTYIKASEPPVEIIVAATKVAGDQVQLTTEPGSELAVETCDVPVVHGNYDAVESAT
ATTAMSNQNLPNTTPLLSSPPFSDCVFLPKDAFFSLLNVTTGQQPKIVPPVSVHPPVTEQYQMLPYSESA
AKIAEHESNRYHSPCQAMYPYWQYSPVPQYPAALHGYRQSKTLKKRHFQSDSEDELSFPGDPEYTKKRRR
HRVDNDDDKEMAREKNDLRELVDMIGMLRQEISALKHVRAQSPQRHIVPMETLPTIEEKGAASPKPSILN
ASLAPETVNRSLAGQNESTDLLKLNKKLFVDALNKMDS

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001664
ORF Size 1584 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001664.2, NP_042946
RefSeq ORF 1584 bp
Locus ID 1487933
MW 58.6 kDa
Write Your Own Review
You're reviewing:U53 (NC_001664) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC101352 Myc-DDK-tagged ORF clone of viral ORF for protein DR1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042883 10 ug
$694.00
VC101353 Myc-DDK-tagged ORF clone of viral ORF for protein DR6 [Human herpesvirus 6], codon optimized for human cell expression, NP_042888 10 ug
$503.00
VC101354 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL23 [Human herpesvirus 6], codon optimized for human cell expression, NP_042893 10 ug
$503.00
VC101355 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042894 10 ug
$503.00
VC101356 Myc-DDK-tagged ORF clone of viral ORF for protein UL27 [Human herpesvirus 6], codon optimized for human cell expression, NP_042895 10 ug
$548.00
VC101357 Myc-DDK-tagged ORF clone of viral ORF for protein UL28 [Human herpesvirus 6], codon optimized for human cell expression, NP_042898 10 ug
$1,175.00
VC101358 Myc-DDK-tagged ORF clone of viral ORF for protein UL31 [Human herpesvirus 6], codon optimized for human cell expression, NP_042901 10 ug
$503.00
VC101359 Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp150 [Human herpesvirus 6], codon optimized for human cell expression, NP_042902 10 ug
$876.00
VC101360 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL33 [Human herpesvirus 6], codon optimized for human cell expression, NP_042903 10 ug
$503.00
VC101361 Myc-DDK-tagged ORF clone of viral ORF for protein U13 [Human herpesvirus 6], codon optimized for human cell expression, NP_042905 10 ug
$165.00
VC101362 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL35 [Human herpesvirus 6], codon optimized for human cell expression, NP_042906 10 ug
$624.00
VC101363 Myc-DDK-tagged ORF clone of viral ORF for protein U15 [Human herpesvirus 6], codon optimized for human cell expression, NP_042907 10 ug
$330.00
VC101364 Myc-DDK-tagged ORF clone of viral ORF for tegument protein vICA [Human herpesvirus 6], codon optimized for human cell expression, NP_042910 10 ug
$503.00
VC101365 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL37 [Human herpesvirus 6], codon optimized for human cell expression, NP_042911 10 ug
$330.00
VC101366 Myc-DDK-tagged ORF clone of viral ORF for protein UL38 [Human herpesvirus 6], codon optimized for human cell expression, NP_042912 10 ug
$503.00
VC101367 Myc-DDK-tagged ORF clone of viral ORF for membrane protein U20 [Human herpesvirus 6], codon optimized for human cell expression, NP_042913 10 ug
$503.00
VC101368 Myc-DDK-tagged ORF clone of viral ORF for membrane protein U21 [Human herpesvirus 6], codon optimized for human cell expression, NP_042914 10 ug
$503.00
VC101369 Myc-DDK-tagged ORF clone of viral ORF for membrane protein U22 [Human herpesvirus 6], codon optimized for human cell expression, NP_042915 10 ug
$330.00
VC101370 Myc-DDK-tagged ORF clone of viral ORF for membrane protein U23 [Human herpesvirus 6], codon optimized for human cell expression, NP_042916 10 ug
$330.00
VC101371 Myc-DDK-tagged ORF clone of viral ORF for protein U24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042917 10 ug
$165.00
VC101372 Myc-DDK-tagged ORF clone of viral ORF for protein U24A [Human herpesvirus 6], codon optimized for human cell expression, YP_002608174 10 ug
$165.00
VC101373 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL43 [Human herpesvirus 6], codon optimized for human cell expression, NP_042918 10 ug
$330.00
VC101374 Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL43 [Human herpesvirus 6], codon optimized for human cell expression, NP_042919 10 ug
$330.00
VC101375 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042920 10 ug
$503.00
VC101376 Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042921 10 ug
$810.00
VC101377 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042922 10 ug
$330.00
VC101378 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 6], codon optimized for human cell expression, NP_042923 10 ug
$942.00
VC101380 Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042925 10 ug
$165.00
VC101381 Myc-DDK-tagged ORF clone of viral ORF for protein UL49 [Human herpesvirus 6], codon optimized for human cell expression, NP_042926 10 ug
$503.00
VC101382 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042927 10 ug
$330.00
VC101383 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 6], codon optimized for human cell expression, NP_042928 10 ug
$165.00
VC101384 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 6], codon optimized for human cell expression, NP_042929 10 ug
$503.00
VC101385 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042930 10 ug
$330.00
VC101386 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042931 10 ug
$969.00
VC101387 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 6], codon optimized for human cell expression, NP_042932 10 ug
$836.00
VC101388 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 6], codon optimized for human cell expression, NP_042933 10 ug
$731.00
VC101389 Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042934 10 ug
$1,084.00
VC101390 Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 6], codon optimized for human cell expression, NP_042935 10 ug
$526.00
VC101391 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042936 10 ug
$866.00
VC101392 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 6], codon optimized for human cell expression, NP_042937 10 ug
$330.00
VC101393 Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 6], codon optimized for human cell expression, NP_042938 10 ug
$503.00
VC101394 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 6], codon optimized for human cell expression, NP_042939 10 ug
$165.00
VC101395 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein O [Human herpesvirus 6], codon optimized for human cell expression, NP_042940 10 ug
$633.00
VC101396 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein 24 [Human herpesvirus 6], codon optimized for human cell expression, YP_002608175 10 ug
$165.00
VC101397 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 6], codon optimized for human cell expression, NP_042941 10 ug
$699.00
VC101398 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042942 10 ug
$330.00
VC101399 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 6], codon optimized for human cell expression, NP_042943 10 ug
$568.00
VC101400 Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL78 [Human herpesvirus 6], codon optimized for human cell expression, NP_042944 10 ug
$330.00
VC101401 Myc-DDK-tagged ORF clone of viral ORF for protein UL79 [Human herpesvirus 6], codon optimized for human cell expression, NP_042945 10 ug
$330.00
VC101403 Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 6], codon optimized for human cell expression, YP_002608176 10 ug
$330.00
VC101404 Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp65 [Human herpesvirus 6], codon optimized for human cell expression, NP_042947 10 ug
$503.00
VC101405 Myc-DDK-tagged ORF clone of viral ORF for protein UL84 [Human herpesvirus 6], codon optimized for human cell expression, NP_042948 10 ug
$503.00
VC101406 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 6], codon optimized for human cell expression, NP_042949 10 ug
$330.00
VC101407 Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042950 10 ug
$1,265.00
VC101408 Myc-DDK-tagged ORF clone of viral ORF for protein UL87 [Human herpesvirus 6], codon optimized for human cell expression, NP_042951 10 ug
$778.00
VC101409 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL88 [Human herpesvirus 6], codon optimized for human cell expression, NP_042952 10 ug
$503.00
VC101410 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042953 10 ug
$682.00
VC101411 Myc-DDK-tagged ORF clone of viral ORF for protein UL91 [Human herpesvirus 6], codon optimized for human cell expression, NP_042955 10 ug
$165.00
VC101412 Myc-DDK-tagged ORF clone of viral ORF for protein UL92 [Human herpesvirus 6], codon optimized for human cell expression, NP_042956 10 ug
$330.00
VC101413 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL17 [Human herpesvirus 6], codon optimized for human cell expression, NP_042957 10 ug
$503.00
VC101414 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 6], codon optimized for human cell expression, NP_042958 10 ug
$503.00
VC101415 Myc-DDK-tagged ORF clone of viral ORF for protein UL95 [Human herpesvirus 6], codon optimized for human cell expression, NP_042960 10 ug
$503.00
VC101416 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 6], codon optimized for human cell expression, NP_042961 10 ug
$165.00
VC101417 Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 6], codon optimized for human cell expression, NP_042962 10 ug
$575.00
VC101418 Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 6], codon optimized for human cell expression, NP_042963 10 ug
$503.00
VC101419 Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042964 10 ug
$165.00
VC101420 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 6], codon optimized for human cell expression, NP_042965 10 ug
$503.00
VC101421 Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 6], codon optimized for human cell expression, NP_042966 10 ug
$786.00
VC101422 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042967 10 ug
$678.00
VC101423 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 6], codon optimized for human cell expression, NP_042968 10 ug
$330.00
VC101424 Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042969 10 ug
$661.00
VC101425 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042970 10 ug
$830.00
VC101426 Myc-DDK-tagged ORF clone of viral ORF for protein UL112 [Human herpesvirus 6], codon optimized for human cell expression, NP_042972 10 ug
$289.00 MSRP $503.00 MSRP $503.00
VC101427 Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 6], codon optimized for human cell expression, NP_042974 10 ug
$330.00
VC101428 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 6], codon optimized for human cell expression, NP_042975 10 ug
$330.00
VC101429 Myc-DDK-tagged ORF clone of viral ORF for chemokine U83 [Human herpesvirus 6], codon optimized for human cell expression, NP_042976 10 ug
$165.00
VC101430 Myc-DDK-tagged ORF clone of viral ORF for protein UL117 [Human herpesvirus 6], codon optimized for human cell expression, NP_042977 10 ug
$503.00
VC101431 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL119 [Human herpesvirus 6], codon optimized for human cell expression, NP_042978 10 ug
$330.00
VC101433 Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042983 10 ug
$948.00
VC101434 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL124 [Human herpesvirus 6], codon optimized for human cell expression, NP_042984 10 ug
$165.00
VC101435 Myc-DDK-tagged ORF clone of viral ORF for protein U94/rep [Human herpesvirus 6], codon optimized for human cell expression, NP_042987 10 ug
$503.00
VC101436 Myc-DDK-tagged ORF clone of viral ORF for protein U95 [Human herpesvirus 6], codon optimized for human cell expression, NP_042988 10 ug
$1,073.00
VC101437 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein Q [Human herpesvirus 6], codon optimized for human cell expression, NP_042993 10 ug
$672.00
VC101438 Myc-DDK-tagged ORF clone of viral ORF for protein DR1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042995 10 ug
$694.00
VC101439 Myc-DDK-tagged ORF clone of viral ORF for US22 family [Human herpesvirus 6], codon optimized for human cell expression, NP_043000 10 ug
$503.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.