UL45 (NC_006273) Virus Tagged ORF Clone

SKU
VC101234
Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081503
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$912.00
5 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol UL45
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101234 represents NCBI reference of YP_081503 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCCGGCCGATGCAGACGAGGAGCAGCGCGTGAGCTCAGTTCCTGCGCATAGATGCAGACCAGGGA
GAATTCCTAGCAGGTCCGCCGAGACCGAAACAGAGGAGTCATCTGCCGAAGTGGCCGCCGACACCATAGG
CGGAGACGATTCTGAACTGGAGGAGGGGCCACTGCCTGGCGGGGATAAGGAGGCGTCCGCGGGTAATACC
AATGTCTCTTCTGGTGTGGCCTGCGTTGCAGGCTTCACTAGCGGCGGCGGCGTTGTGTCCTGGCGACCAG
AGTCACCGAGCCCGGACGGGACCCCAAGTGTGTTGAGCCTCACAAGGGATTCTGGACCCGCAGTGCCAAG
CCGGGGCGGCAGGGTCTCCTCAGGGCTCAGTACCTTCAACCCCGCCGGAGCAACCCGCATGGAACTGGAC
TCTGTTGAGGAAGAAGACGACTTCGGCGCATCACTGTGTAAAGTGTCTCCCCCCATTCAGGCTATGCGCA
TGCTGATGGGAAAGAAATGCCACTGCCATGGTTACTGGGGCAAATTTCGGTTTTGTGGCGTGCAGGAGCC
CGCGCGAGAACTTCCATCTGACCGAAACGCACTTTGGAGAGAGATGGACACTGTGTCTCGCCATTCTGCA
GGTCTCGGGAGTTTCCGCCTGTTTCAGCTGATTATGAGACACGGACCCTGCCTGATACGACACAGCCCTC
GGTGCGATCTCCTGCTGGGTAGGTTTTATTTCAAAGCCAACTGGGCTAGAGAAAGCAGAACGCCGCTCTG
CTACGCTAGTGAGCTCTGTGACGAGTCCGTGCGGAGGTTTGTACTGCGGCATATGGAGGATCTTCCAAAG
CTGGCCGAGGAAACGGCTAGATTCGTTGAACTGGCCGGGTGCTGGGGTTTGTACGCAGCTATTCTCTGCC
TCGACAAAGTCTGTCGGCAGTTGCACGGACAGGATGAAAGTCCGGGCGGGGTGTTTTTGAGAATAGCCGT
GGCGCTGACGGCTGCCATCGAAAATTCCCGCCATAGTCGAATTTATCGCTTTCACTTGGACGCCAGATTC
GAGGGAGAGGTCCTGGAGTCCGTGCTGAAAAGATGCCGAGACGGGCAGCTCTCACTGTCAACCTTTACTA
TGTCAACCGTGGGGTTCGATCGGGTACCCCAGTACGACTTCCTCATCAGCGCCGACCCTTTTTCCCGCGA
CGCCAGTTGGGCCGCCATGTGCAAGTGGATGTCCACATTGAGCTGTGGAGTGTCCGTGTCAGTGAACGTC
ACCAGGCTGAATGCCGACGTGAACTCCGTGATTCGCTGTCTCGGTGGTTACTGTGACCTGATCAGGGAGA
AAGAGGTGCATAGACCTGTGGTGAGGGTGTTTGTGGACATGTGGGACGTGGCAGCTATCCGAGTGATCAA
CTTTATACTGAAGGAGTCAACCTCAGAGCTCACCGGAGTGTGCTATGCCTTTAATGTTCCATCCGTGCTG
ATGAAGCGGTACAGGGCCAGAGAGCAGAGGTATAGTCTGTTTGGGCGGCCCGTCTCAAGGAGACTGTCTG
ACTTGGGCCAGGAATCCGCTTTCGAGAAGGAATACTCACGGTGTGAACAGTCTTGTCCTAAGGTGGTCGT
GAATACTGATGACTTTTTGAAGAAGATGCTGTTGTGTGCACTGAAGGGTCGGGCGTCTGTGGTGTTTGTC
CACCACGTCGTCAAATACTCCATCATGGCGGATAGTGTATGCCTCCCTCCTTGTTTGTCACCAGACATGG
CCAGCTGCCACTTTGGTGAATGTGACATGCCTGTGCAGCGCCTTACAGTGAATGTTGCACGCTGTGTGTT
CGCCCGGTCTGACGAGCAGAAGCTTCACCTTCCCGATGTGGTGCTGGGAAATACACGGCGCTACTTCGAT
CTCTCCGTGCTGCGGGAACTGGTCACAGAAGCAGTTGTATGGGGAAATGCAAGACTGGACGCTTTGATGT
CCGCCTCCGAGTGGTGGGTGGAATCTGCCCTTGAGAAGCTGCGGCCTCTGCACATCGGCGTTGCCGGCCT
GCACACTGCGCTGATGCGGTTGGGCTTCACCTATTTCGCAAGCTGGGATCTGATCGAGCGAATCTTCGAA
CACATGTACTTTGCAGCAGTCCGGGCCTCAGTGGACCTTTGTAAGTCCGGCCTGCCTCGCTGCGAGTGGT
TTGAGAGGACTATTTATCAGGAGGGCAAGTTCATTTTCGAACTCTATAGGCTGCCTCGCTTGTCCATTGC
TAGCGCAAGGTGGGAAGCATTGCGGGCCGACATGTTGGAGTTTGGTCTGAGGAACTGCCAATTCCTCGCT
GTGGGGCCAGATGATGAGGTGGCTCATCTTTGGGGGGTGACCCCTAGCGTCTGGGCTAGTCGGGGCACCG
TATTCGAGGAAGAGACTGTGTGGAGTCTCTGCCCACCTAATCGGGAATGCTACTTCCCCACAGTCGTCCG
CAGACCACTGCGGGTACCGGTGGTCAATTACGCCTGGCTCGAACAGCATCAAGAGGAGGGAAAGGCCACA
CAGTGCCTCTTCCAGGCAGCTCCGGCTATCCAGAATGACGTCGAGATGGCTGCCGTGAATCTGAGCGTCT
TTGTTGACCAGTGCGTGGCTCTCGTTTTTTATTACGACTCTGGCATGACACCCGACGTGCTTCTGGCCAG
GATGCTCAAGTGGTACCACTGGCGGTTTAAGGTCGGTGTTTATAAGTACTGTGCGTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101234 representing YP_081503
Red=Cloning sites Green=Tags

MNPADADEEQRVSSVPAHRCRPGRIPSRSAETETEESSAEVAADTIGGDDSELEEGPLPGGDKEASAGNT
NVSSGVACVAGFTSGGGVVSWRPESPSPDGTPSVLSLTRDSGPAVPSRGGRVSSGLSTFNPAGATRMELD
SVEEEDDFGASLCKVSPPIQAMRMLMGKKCHCHGYWGKFRFCGVQEPARELPSDRNALWREMDTVSRHSA
GLGSFRLFQLIMRHGPCLIRHSPRCDLLLGRFYFKANWARESRTPLCYASELCDESVRRFVLRHMEDLPK
LAEETARFVELAGCWGLYAAILCLDKVCRQLHGQDESPGGVFLRIAVALTAAIENSRHSRIYRFHLDARF
EGEVLESVLKRCRDGQLSLSTFTMSTVGFDRVPQYDFLISADPFSRDASWAAMCKWMSTLSCGVSVSVNV
TRLNADVNSVIRCLGGYCDLIREKEVHRPVVRVFVDMWDVAAIRVINFILKESTSELTGVCYAFNVPSVL
MKRYRAREQRYSLFGRPVSRRLSDLGQESAFEKEYSRCEQSCPKVVVNTDDFLKKMLLCALKGRASVVFV
HHVVKYSIMADSVCLPPCLSPDMASCHFGECDMPVQRLTVNVARCVFARSDEQKLHLPDVVLGNTRRYFD
LSVLRELVTEAVVWGNARLDALMSASEWWVESALEKLRPLHIGVAGLHTALMRLGFTYFASWDLIERIFE
HMYFAAVRASVDLCKSGLPRCEWFERTIYQEGKFIFELYRLPRLSIASARWEALRADMLEFGLRNCQFLA
VGPDDEVAHLWGVTPSVWASRGTVFEEETVWSLCPPNRECYFPTVVRRPLRVPVVNYAWLEQHQEEGKAT
QCLFQAAPAIQNDVEMAAVNLSVFVDQCVALVFYYDSGMTPDVLLARMLKWYHWRFKVGVYKYCAS

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_006273
ORF Size 2718 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_006273.2, YP_081503
RefSeq ORF 2718 bp
Locus ID 3077444
MW 101.7 kDa
Write Your Own Review
You're reviewing:UL45 (NC_006273) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC101187 Myc-DDK-tagged ORF clone of viral ORF for protein RL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081455 10 ug
$330.00
VC101188 Myc-DDK-tagged ORF clone of viral ORF for protein RL5A [Human herpesvirus 5], codon optimized for human cell expression, YP_081456 10 ug
$165.00
VC101189 Myc-DDK-tagged ORF clone of viral ORF for protein RL6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081457 10 ug
$165.00
VC101190 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein RL10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081458 10 ug
$330.00
VC101191 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein RL11 [Human herpesvirus 5], codon optimized for human cell expression, YP_081459 10 ug
$330.00
VC101192 Myc-DDK-tagged ORF clone of viral ORF for membrane protein RL12 [Human herpesvirus 5], codon optimized for human cell expression, YP_081460 10 ug
$503.00
VC101193 Myc-DDK-tagged ORF clone of viral ORF for membrane protein RL13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081461 10 ug
$330.00
VC101194 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081462 10 ug
$330.00
VC101195 Myc-DDK-tagged ORF clone of viral ORF for protein UL2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081463 10 ug
$165.00
VC101196 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL4 [Human herpesvirus 5], codon optimized for human cell expression, YP_081464 10 ug
$165.00
VC101197 Myc-DDK-tagged ORF clone of viral ORF for protein UL5 [Human herpesvirus 5], codon optimized for human cell expression, YP_081465 10 ug
$165.00
VC101198 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081466 10 ug
$330.00
VC101199 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081467 10 ug
$330.00
VC101200 Myc-DDK-tagged ORF clone of viral ORF for protein UL8 [Human herpesvirus 5], codon optimized for human cell expression, YP_081468 10 ug
$165.00
VC101201 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL9 [Human herpesvirus 5], codon optimized for human cell expression, YP_081469 10 ug
$330.00
VC101202 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081470 10 ug
$450.00
VC101204 Myc-DDK-tagged ORF clone of viral ORF for protein UL13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081472 10 ug
$503.00
VC101205 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081473 10 ug
$330.00
VC101206 Myc-DDK-tagged ORF clone of viral ORF for protein UL15A [Human herpesvirus 5], codon optimized for human cell expression, YP_081474 10 ug
$165.00
VC101207 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081475 10 ug
$450.00
VC101208 Myc-DDK-tagged ORF clone of viral ORF for protein UL17 [Human herpesvirus 5], codon optimized for human cell expression, YP_081476 10 ug
$165.00
VC101209 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL18 [Human herpesvirus 5], codon optimized for human cell expression, YP_081477 10 ug
$289.00 MSRP $503.00 MSRP $503.00
VC101210 Myc-DDK-tagged ORF clone of viral ORF for protein UL19 [Human herpesvirus 5], codon optimized for human cell expression, YP_081478 10 ug
$165.00
VC101211 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL20 [Human herpesvirus 5], codon optimized for human cell expression, YP_081479 10 ug
$503.00
VC101212 Myc-DDK-tagged ORF clone of viral ORF for protein UL21A [Human herpesvirus 5], codon optimized for human cell expression, YP_081480 10 ug
$165.00
VC101213 Myc-DDK-tagged ORF clone of viral ORF for glycoprotein UL22A [Human herpesvirus 5], codon optimized for human cell expression, YP_081481 10 ug
$165.00
VC101214 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL23 [Human herpesvirus 5], codon optimized for human cell expression, YP_081482 10 ug
$330.00
VC101215 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL24 [Human herpesvirus 5], codon optimized for human cell expression, YP_081483 10 ug
$330.00
VC101216 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL25 [Human herpesvirus 5], codon optimized for human cell expression, YP_081484 10 ug
$672.00
VC101217 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL26 [Human herpesvirus 5], codon optimized for human cell expression, YP_081485 10 ug
$330.00
VC101218 Myc-DDK-tagged ORF clone of viral ORF for protein UL27 [Human herpesvirus 5], codon optimized for human cell expression, YP_081486 10 ug
$622.00
VC101219 Myc-DDK-tagged ORF clone of viral ORF for protein UL29 [Human herpesvirus 5], codon optimized for human cell expression, YP_081487 10 ug
$705.00
VC101220 Myc-DDK-tagged ORF clone of viral ORF for protein UL30 [Human herpesvirus 5], codon optimized for human cell expression, YP_081489 10 ug
$165.00
VC101221 Myc-DDK-tagged ORF clone of viral ORF for protein UL31 [Human herpesvirus 5], codon optimized for human cell expression, YP_081490 10 ug
$609.00
VC101222 Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp150 [Human herpesvirus 5], codon optimized for human cell expression, YP_081491 10 ug
$1,004.00
VC101223 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL33 [Human herpesvirus 5], codon optimized for human cell expression, YP_081492 10 ug
$503.00
VC101224 Myc-DDK-tagged ORF clone of viral ORF for protein UL34 [Human herpesvirus 5], codon optimized for human cell expression, YP_081493 10 ug
$503.00
VC101225 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL35 [Human herpesvirus 5], codon optimized for human cell expression, YP_081494 10 ug
$656.00
VC101226 Myc-DDK-tagged ORF clone of viral ORF for tegument protein vICA [Human herpesvirus 5], codon optimized for human cell expression, YP_081495 10 ug
$503.00
VC101227 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL37 [Human herpesvirus 5], codon optimized for human cell expression, YP_081496 10 ug
$503.00
VC101228 Myc-DDK-tagged ORF clone of viral ORF for protein UL38 [Human herpesvirus 5], codon optimized for human cell expression, YP_081497 10 ug
$330.00
VC101229 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL40 [Human herpesvirus 5], codon optimized for human cell expression, YP_081498 10 ug
$289.00 MSRP $330.00 MSRP $330.00
VC101230 Myc-DDK-tagged ORF clone of viral ORF for protein UL41A [Human herpesvirus 5], codon optimized for human cell expression, YP_081499 10 ug
$165.00
VC101231 Myc-DDK-tagged ORF clone of viral ORF for protein UL42 [Human herpesvirus 5], codon optimized for human cell expression, YP_081500 10 ug
$165.00
VC101232 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL43 [Human herpesvirus 5], codon optimized for human cell expression, YP_081501 10 ug
$503.00
VC101233 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081502 10 ug
$503.00
VC101235 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081504 10 ug
$330.00
VC101236 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 5], codon optimized for human cell expression, YP_081505 10 ug
$990.00
VC101238 Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081507 10 ug
$165.00
VC101239 Myc-DDK-tagged ORF clone of viral ORF for protein UL49 [Human herpesvirus 5], codon optimized for human cell expression, YP_081508 10 ug
$584.00
VC101240 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081509 10 ug
$503.00
VC101241 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 5], codon optimized for human cell expression, YP_081510 10 ug
$165.00
VC101242 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 5], codon optimized for human cell expression, YP_081511 10 ug
$673.00
VC101243 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081512 10 ug
$503.00
VC101244 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081513 10 ug
$1,189.00
VC101245 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 5], codon optimized for human cell expression, YP_081514 10 ug
$913.00
VC101246 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081515 10 ug
$856.00
VC101248 Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 5], codon optimized for human cell expression, YP_081517 10 ug
$747.00
VC101249 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081518 10 ug
$953.00
VC101250 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 5], codon optimized for human cell expression, YP_081519 10 ug
$503.00
VC101251 Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 5], codon optimized for human cell expression, YP_081520 10 ug
$503.00
VC101252 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 5], codon optimized for human cell expression, YP_081521 10 ug
$165.00
VC101253 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein O [Human herpesvirus 5], codon optimized for human cell expression, YP_081522 10 ug
$503.00
VC101254 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein 24, partial [Human herpesvirus 5], codon optimized for human cell expression, YP_002802310 10 ug
$165.00
VC101255 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 5], codon optimized for human cell expression, YP_081523 10 ug
$747.00
VC101258 Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL78 [Human herpesvirus 5], codon optimized for human cell expression, YP_081526 10 ug
$503.00
VC101259 Myc-DDK-tagged ORF clone of viral ORF for protein UL79 [Human herpesvirus 5], codon optimized for human cell expression, YP_081527 10 ug
$330.00
VC101262 Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp71 [Human herpesvirus 5], codon optimized for human cell expression, YP_081530 10 ug
$289.00 MSRP $520.00 MSRP $520.00
VC101263 Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp65 [Human herpesvirus 5], codon optimized for human cell expression, YP_081531 10 ug
$289.00 MSRP $522.00 MSRP $522.00
VC101264 Myc-DDK-tagged ORF clone of viral ORF for protein UL84 [Human herpesvirus 5], codon optimized for human cell expression, YP_081532 10 ug
$601.00
VC101265 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081533 10 ug
$330.00
VC101267 Myc-DDK-tagged ORF clone of viral ORF for protein UL87 [Human herpesvirus 5], codon optimized for human cell expression, YP_081535 10 ug
$948.00
VC101268 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL88 [Human herpesvirus 5], codon optimized for human cell expression, YP_081536 10 ug
$503.00
VC101269 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081537 10 ug
$679.00
VC101270 Myc-DDK-tagged ORF clone of viral ORF for protein UL91 [Human herpesvirus 5], codon optimized for human cell expression, YP_081538 10 ug
$165.00
VC101271 Myc-DDK-tagged ORF clone of viral ORF for protein UL92 [Human herpesvirus 5], codon optimized for human cell expression, YP_081539 10 ug
$330.00
VC101273 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081541 10 ug
$503.00
VC101275 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081543 10 ug
$165.00
VC101276 Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 5], codon optimized for human cell expression, YP_081544 10 ug
$712.00
VC101277 Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 5], codon optimized for human cell expression, YP_081545 10 ug
$598.00
VC101278 Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081546 10 ug
$330.00
VC101279 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 5], codon optimized for human cell expression, YP_081547 10 ug
$503.00
VC101281 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081549 10 ug
$330.00
VC101282 Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081550 10 ug
$702.00
VC101284 Myc-DDK-tagged ORF clone of viral ORF for interleukin-10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081552 10 ug
$330.00
VC101286 Myc-DDK-tagged ORF clone of viral ORF for large tegument protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081554 10 ug
$330.00
VC101287 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 5], codon optimized for human cell expression, YP_081555 10 ug
$330.00
VC101291 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL120 [Human herpesvirus 5], codon optimized for human cell expression, YP_081559 10 ug
$330.00
VC101292 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL121 [Human herpesvirus 5], codon optimized for human cell expression, YP_081560 10 ug
$330.00
VC101293 Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081561 10 ug
$810.00
VC101294 Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081562 10 ug
$289.00 MSRP $503.00 MSRP $503.00
VC101295 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL124 [Human herpesvirus 5], codon optimized for human cell expression, YP_081563 10 ug
$165.00
VC101296 Myc-DDK-tagged ORF clone of viral ORF for truncated envelope protein UL128 [Human herpesvirus 5], codon optimized for human cell expression, YP_081564 10 ug
$165.00
VC101297 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL130 [Human herpesvirus 5], codon optimized for human cell expression, YP_081565 10 ug
$330.00
VC101298 Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL131A [Human herpesvirus 5], codon optimized for human cell expression, YP_081566 10 ug
$165.00
VC101299 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL132 [Human herpesvirus 5], codon optimized for human cell expression, YP_081567 10 ug
$330.00
VC101300 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL148 [Human herpesvirus 5], codon optimized for human cell expression, YP_081568 10 ug
$330.00
VC101301 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL147A [Human herpesvirus 5], codon optimized for human cell expression, YP_081569 10 ug
$165.00
VC101302 Myc-DDK-tagged ORF clone of viral ORF for chemokine vCXCL2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081570 10 ug
$165.00
VC101303 Myc-DDK-tagged ORF clone of viral ORF for chemokine vCXCL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081571 10 ug
$165.00
VC101304 Myc-DDK-tagged ORF clone of viral ORF for protein UL145 [Human herpesvirus 5], codon optimized for human cell expression, YP_081572 10 ug
$165.00
VC101305 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL144 [Human herpesvirus 5], codon optimized for human cell expression, YP_081573 10 ug
$450.00
VC101306 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL142 [Human herpesvirus 5], codon optimized for human cell expression, YP_081574 10 ug
$450.00
VC101307 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL141 [Human herpesvirus 5], codon optimized for human cell expression, YP_081575 10 ug
$289.00 MSRP $457.00 MSRP $457.00
VC101308 Myc-DDK-tagged ORF clone of viral ORF for protein UL140 [Human herpesvirus 5], codon optimized for human cell expression, YP_081576 10 ug
$330.00
VC101309 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL139 [Human herpesvirus 5], codon optimized for human cell expression, YP_081577 10 ug
$165.00
VC101310 Myc-DDK-tagged ORF clone of viral ORF for protein UL138 [Human herpesvirus 5], codon optimized for human cell expression, YP_081578 10 ug
$450.00
VC101312 Myc-DDK-tagged ORF clone of viral ORF for protein UL135 [Human herpesvirus 5], codon optimized for human cell expression, YP_081580 10 ug
$330.00
VC101314 Myc-DDK-tagged ORF clone of viral ORF for protein UL148A [Human herpesvirus 5], codon optimized for human cell expression, YP_081582 10 ug
$165.00
VC101315 Myc-DDK-tagged ORF clone of viral ORF for protein UL148B [Human herpesvirus 5], codon optimized for human cell expression, YP_081583 10 ug
$165.00
VC101316 Myc-DDK-tagged ORF clone of viral ORF for protein UL148C [Human herpesvirus 5], codon optimized for human cell expression, YP_081584 10 ug
$165.00
VC101317 Myc-DDK-tagged ORF clone of viral ORF for protein UL148D [Human herpesvirus 5], codon optimized for human cell expression, YP_081585 10 ug
$165.00
VC101318 Myc-DDK-tagged ORF clone of viral ORF for protein UL150 [Human herpesvirus 5], codon optimized for human cell expression, YP_081586 10 ug
$654.00
VC101321 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081589 10 ug
$289.00 MSRP $330.00 MSRP $330.00
VC101322 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US3 [Human herpesvirus 5], codon optimized for human cell expression, YP_081590 10 ug
$330.00
VC101323 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081591 10 ug
$330.00
VC101324 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081592 10 ug
$330.00
VC101325 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US8 [Human herpesvirus 5], codon optimized for human cell expression, YP_081593 10 ug
$330.00
VC101326 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US9 [Human herpesvirus 5], codon optimized for human cell expression, YP_081594 10 ug
$330.00
VC101327 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081595 10 ug
$330.00
VC101328 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US11 [Human herpesvirus 5], codon optimized for human cell expression, YP_081596 10 ug
$289.00 MSRP $300.00 MSRP $300.00
VC101329 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US12 [Human herpesvirus 5], codon optimized for human cell expression, YP_081597 10 ug
$330.00
VC101330 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081598 10 ug
$330.00
VC101331 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081599 10 ug
$330.00
VC101332 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US15 [Human herpesvirus 5], codon optimized for human cell expression, YP_081600 10 ug
$330.00
VC101333 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081601 10 ug
$330.00
VC101334 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US17 [Human herpesvirus 5], codon optimized for human cell expression, YP_081602 10 ug
$330.00
VC101335 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US18 [Human herpesvirus 5], codon optimized for human cell expression, YP_081603 10 ug
$330.00
VC101336 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US19 [Human herpesvirus 5], codon optimized for human cell expression, YP_081604 10 ug
$330.00
VC101337 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US20 [Human herpesvirus 5], codon optimized for human cell expression, YP_081605 10 ug
$330.00
VC101338 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US21 [Human herpesvirus 5], codon optimized for human cell expression, YP_081606 10 ug
$330.00
VC101339 Myc-DDK-tagged ORF clone of viral ORF for tegument protein US22 [Human herpesvirus 5], codon optimized for human cell expression, YP_081607 10 ug
$590.00
VC101340 Myc-DDK-tagged ORF clone of viral ORF for protein US23 [Human herpesvirus 5], codon optimized for human cell expression, YP_081608 10 ug
$606.00
VC101342 Myc-DDK-tagged ORF clone of viral ORF for protein US26 [Human herpesvirus 5], codon optimized for human cell expression, YP_081610 10 ug
$617.00
VC101343 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein US27 [Human herpesvirus 5], codon optimized for human cell expression, YP_081611 10 ug
$686.00
VC101344 Myc-DDK-tagged ORF clone of viral ORF for envelope protein US28 [Human herpesvirus 5], codon optimized for human cell expression, YP_081612 10 ug
$289.00 MSRP $457.00 MSRP $457.00
VC101345 Myc-DDK-tagged ORF clone of viral ORF for protein US29 [Human herpesvirus 5], codon optimized for human cell expression, YP_081613 10 ug
$503.00
VC101346 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US30 [Human herpesvirus 5], codon optimized for human cell expression, YP_081614 10 ug
$503.00
VC101347 Myc-DDK-tagged ORF clone of viral ORF for protein US31 [Human herpesvirus 5], codon optimized for human cell expression, YP_081615 10 ug
$165.00
VC101348 Myc-DDK-tagged ORF clone of viral ORF for protein US32 [Human herpesvirus 5], codon optimized for human cell expression, YP_081616 10 ug
$330.00
VC101349 Myc-DDK-tagged ORF clone of viral ORF for protein US34 [Human herpesvirus 5], codon optimized for human cell expression, YP_081617 10 ug
$165.00
VC101350 Myc-DDK-tagged ORF clone of viral ORF for protein US34A [Human herpesvirus 5], codon optimized for human cell expression, YP_081618 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.