ORF1 (NC_001348) Virus Tagged ORF Clone

SKU
VC100941
Myc-DDK-tagged ORF clone of viral ORF for membrane protein V1 [Human herpesvirus 3], codon optimized for human cell expression, NP_040124
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol ORF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC100941 represents NCBI reference of NP_040124 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAGAGTCTCAGAATATGGTGTGCCAGAAGGAGTCAGAGAGTCCGACTCCGACACTGACAGCGTCT
TCATGTATCAGCATACCGAGTTGATGCAAAATAATGCCTCCCCCCTGGTGGTGCAGACCAGACCTCCCGC
AGTGCTTATTCCCCTGGTGGATGTTCCACGCCCACGATCACGGAGGAAGGCGTCAGCTCAGCTGAAAATG
CAAATGGACCGGCTTTGTAACGTCCTGGGTGTGGTCCTTCAGATGGCTACCCTGGCTCTGGTGACGTATA
TCGCTTTCGTAGTTCACACCAGAGCAACCTCATGTAAGCGCGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC100941 representing NP_040124
Red=Cloning sites Green=Tags

MSRVSEYGVPEGVRESDSDTDSVFMYQHTELMQNNASPLVVQTRPPAVLIPLVDVPRPRSRRKASAQLKM
QMDRLCNVLGVVLQMATLALVTYIAFVVHTRATSCKRE

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001348
ORF Size 324 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001348.1, NP_040124
RefSeq ORF 324 bp
Locus ID 1487664
UniProt ID P09310
MW 12.1 kDa
Write Your Own Review
You're reviewing:ORF1 (NC_001348) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC100940 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL56 [Human herpesvirus 3], codon optimized for human cell expression, YP_053044 10 ug
$165.00
VC100942 Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein CIRC [Human herpesvirus 3], codon optimized for human cell expression, NP_040125 10 ug
$330.00
VC100943 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL55 [Human herpesvirus 3], codon optimized for human cell expression, NP_040126 10 ug
$330.00
VC100944 Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 3], codon optimized for human cell expression, NP_040127 10 ug
$732.00
VC100945 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein K [Human herpesvirus 3], codon optimized for human cell expression, NP_040128 10 ug
$503.00
VC100946 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 3], codon optimized for human cell expression, NP_040129 10 ug
$1,037.00
VC100947 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 3], codon optimized for human cell expression, NP_040130 10 ug
$330.00
VC100948 Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 3], codon optimized for human cell expression, NP_040131 10 ug
$503.00
VC100949 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 3], codon optimized for human cell expression, YP_068406 10 ug
$165.00
VC100950 Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP22 [Human herpesvirus 3], codon optimized for human cell expression, NP_040132 10 ug
$330.00
VC100951 Myc-DDK-tagged ORF clone of viral ORF for transactivating tegument protein VP16 [Human herpesvirus 3], codon optimized for human cell expression, NP_040133 10 ug
$503.00
VC100953 Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP11/12 [Human herpesvirus 3], codon optimized for human cell expression, NP_040135 10 ug
$677.00
VC100954 Myc-DDK-tagged ORF clone of viral ORF for thymidylate synthase [Human herpesvirus 3], codon optimized for human cell expression, NP_040136 10 ug
$330.00
VC100956 Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL43 [Human herpesvirus 3], codon optimized for human cell expression, NP_040138 10 ug
$503.00
VC100957 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 3], codon optimized for human cell expression, NP_040139 10 ug
$503.00
VC100958 Myc-DDK-tagged ORF clone of viral ORF for tegument host shutoff protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040140 10 ug
$503.00
VC100959 Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 2 [Human herpesvirus 3], codon optimized for human cell expression, NP_040141 10 ug
$330.00
VC100960 Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 3], codon optimized for human cell expression, NP_040142 10 ug
$781.00
VC100961 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 3], codon optimized for human cell expression, NP_040143 10 ug
$503.00
VC100962 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 3], codon optimized for human cell expression, NP_040144 10 ug
$994.00
VC100964 Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040146 10 ug
$330.00
VC100965 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040147 10 ug
$330.00
VC100966 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 3], codon optimized for human cell expression, NP_040148 10 ug
$165.00
VC100967 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 3], codon optimized for human cell expression, NP_040149 10 ug
$599.00
VC100968 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040150 10 ug
$330.00
VC100969 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 3], codon optimized for human cell expression, NP_040151 10 ug
$1,143.00
VC100970 Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040152 10 ug
$1,153.00
VC100971 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 3], codon optimized for human cell expression, NP_040153 10 ug
$776.00
VC100972 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 3], codon optimized for human cell expression, NP_040154 10 ug
$938.00
VC100973 Myc-DDK-tagged ORF clone of viral ORF for protein V32 [Human herpesvirus 3], codon optimized for human cell expression, NP_040155 10 ug
$165.00
VC100974 Myc-DDK-tagged ORF clone of viral ORF for capsid maturation protease [Human herpesvirus 3], codon optimized for human cell expression, NP_040156 10 ug
$619.00
VC100975 Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 3], codon optimized for human cell expression, YP_068407 10 ug
$330.00
VC100976 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 3], codon optimized for human cell expression, NP_040157 10 ug
$593.00
VC100977 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 3], codon optimized for human cell expression, NP_040158 10 ug
$330.00
VC100978 Myc-DDK-tagged ORF clone of viral ORF for thymidine kinase [Human herpesvirus 3], codon optimized for human cell expression, NP_040159 10 ug
$503.00
VC100979 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 3], codon optimized for human cell expression, NP_040160 10 ug
$847.00
VC100980 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL21 [Human herpesvirus 3], codon optimized for human cell expression, NP_040161 10 ug
$554.00
VC100981 Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL20 [Human herpesvirus 3], codon optimized for human cell expression, NP_040162 10 ug
$330.00
VC100982 Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040163 10 ug
$1,313.00
VC100983 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 3], codon optimized for human cell expression, NP_040164 10 ug
$330.00
VC100984 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 3], codon optimized for human cell expression, NP_040165 10 ug
$752.00
VC100985 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL17 [Human herpesvirus 3], codon optimized for human cell expression, NP_040166 10 ug
$681.00
VC100986 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 3], codon optimized for human cell expression, NP_040167 10 ug
$503.00
VC100987 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 3], codon optimized for human cell expression, NP_040168 10 ug
$330.00
VC100988 Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 3], codon optimized for human cell expression, NP_040169 10 ug
$522.00
VC100989 Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 3], codon optimized for human cell expression, NP_040170 10 ug
$564.00
VC100990 Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040171 10 ug
$165.00
VC100991 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 3], codon optimized for human cell expression, NP_040172 10 ug
$503.00
VC100992 Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 3], codon optimized for human cell expression, NP_040173 10 ug
$841.00
VC100993 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 3], codon optimized for human cell expression, NP_040174 10 ug
$777.00
VC100994 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 3], codon optimized for human cell expression, NP_040175 10 ug
$330.00
VC100995 Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040176 10 ug
$774.00
VC100996 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 3], codon optimized for human cell expression, NP_040177 10 ug
$887.00
VC100997 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL4 [Human herpesvirus 3], codon optimized for human cell expression, NP_040178 10 ug
$330.00
VC100998 Myc-DDK-tagged ORF clone of viral ORF for protein V57 [Human herpesvirus 3], codon optimized for human cell expression, NP_040179 10 ug
$165.00
VC100999 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL3 [Human herpesvirus 3], codon optimized for human cell expression, NP_040180 10 ug
$330.00
VC101000 Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 3], codon optimized for human cell expression, NP_040181 10 ug
$330.00
VC101001 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 3], codon optimized for human cell expression, NP_040182 10 ug
$165.00
VC101002 Myc-DDK-tagged ORF clone of viral ORF for ubiquitin E3 ligase ICP0 [Human herpesvirus 3], codon optimized for human cell expression, NP_040183 10 ug
$503.00
VC101004 Myc-DDK-tagged ORF clone of viral ORF for regulatory protein ICP22 [Human herpesvirus 3], codon optimized for human cell expression, NP_040185 10 ug
$330.00
VC101005 Myc-DDK-tagged ORF clone of viral ORF for virion protein US10 [Human herpesvirus 3], codon optimized for human cell expression, NP_040186 10 ug
$330.00
VC101006 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US9 [Human herpesvirus 3], codon optimized for human cell expression, NP_040187 10 ug
$165.00
VC101007 Myc-DDK-tagged ORF clone of viral ORF for serine/threonine protein kinase US3 [Human herpesvirus 3], codon optimized for human cell expression, NP_040188 10 ug
$503.00
VC101008 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein I [Human herpesvirus 3], codon optimized for human cell expression, NP_040189 10 ug
$503.00
VC101009 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein E [Human herpesvirus 3], codon optimized for human cell expression, NP_040190 10 ug
$638.00
VC101010 Myc-DDK-tagged ORF clone of viral ORF for virion protein US10 [Human herpesvirus 3], codon optimized for human cell expression, NP_040191 10 ug
$330.00
VC101011 Myc-DDK-tagged ORF clone of viral ORF for regulatory protein ICP22 [Human herpesvirus 3], codon optimized for human cell expression, NP_040192 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.