US8A (NC_001806) Virus Tagged ORF Clone

SKU
VC100857
Myc-DDK-tagged ORF clone of viral ORF for membrane protein US8A [Human herpesvirus 1], codon optimized for human cell expression, NP_044671
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol US8A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC100857 represents NCBI reference of NP_044671 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCCTGCTCTGAGATCCTATCACCAACGGCTTCGCCTCTACACACCAGTGGCCATGGGGATCAACC
TTGCGGCCAGCTCCCAACCCCTGGACCCTGAGGGTCCCATCGCAGTAACTCCGAGGCCCCCAATCCGACC
AAGCAGTGGAAAAGCCCCGCACCCTGAGGCCCCACGGAGGAGCCCAAATTGGGCGACAGCGGGCGAAGTG
GACGTTGGAGACGAGCTGATCGCCATTTCAGATGAAAGAGGTCCCCCACGCCACGATCGACCTCCCTTGG
CAACATCCACCGCACCTAGTCCTCACCCTCGCCCACCAGGATATACAGCCGTTGTCAGCCCAATGGCATT
GCAGGCCGTTGATGCACCAAGCCTGTTCGTGGCATGGCTTGCAGCTCGCTGGCTCAGGGGAGCCAGCGGG
CTCGGAGCAGTTCTCTGTGGTATTGCTTGGTACGTGACTTCAATTGCACGCGGTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC100857 representing NP_044671
Red=Cloning sites Green=Tags

MDPALRSYHQRLRLYTPVAMGINLAASSQPLDPEGPIAVTPRPPIRPSSGKAPHPEAPRRSPNWATAGEV
DVGDELIAISDERGPPRHDRPPLATSTAPSPHPRPPGYTAVVSPMALQAVDAPSLFVAWLAARWLRGASG
LGAVLCGIAWYVTSIARGA

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001806
ORF Size 477 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001806.1, NP_044671
RefSeq ORF 477 bp
Locus ID 2703450
UniProt ID P04413
MW 16.8 kDa
Write Your Own Review
You're reviewing:US8A (NC_001806) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC100788 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 1], codon optimized for human cell expression, NP_044602 10 ug
$480.00
VC100789 Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 1], codon optimized for human cell expression, NP_044603 10 ug
$503.00
VC100790 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL3 [Human herpesvirus 1], codon optimized for human cell expression, NP_044604 10 ug
$330.00
VC100791 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL4 [Human herpesvirus 1], codon optimized for human cell expression, NP_044605 10 ug
$330.00
VC100792 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044606 10 ug
$589.00 MSRP $888.00 MSRP $888.00
VC100793 Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044607 10 ug
$681.00
VC100794 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 1], codon optimized for human cell expression, NP_044608 10 ug
$330.00
VC100795 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044609 10 ug
$589.00 MSRP $755.00 MSRP $755.00
VC100796 Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 1], codon optimized for human cell expression, NP_044610 10 ug
$857.00
VC100797 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 1], codon optimized for human cell expression, NP_044611 10 ug
$503.00
VC100798 Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044612 10 ug
$165.00
VC100799 Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 1], codon optimized for human cell expression, NP_044613 10 ug
$641.00
VC100800 Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 1], codon optimized for human cell expression, NP_044614 10 ug
$723.00
VC100801 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 1], codon optimized for human cell expression, NP_044615 10 ug
$450.00
VC100802 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 1], codon optimized for human cell expression, NP_044616 10 ug
$740.00
VC100803 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 1], codon optimized for human cell expression, NP_044617 10 ug
$503.00
VC100805 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044619 10 ug
$330.00
VC100806 Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044620 10 ug
$1,293.00
VC100807 Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL20 [Human herpesvirus 1], codon optimized for human cell expression, NP_044621 10 ug
$330.00
VC100808 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL21 [Human herpesvirus 1], codon optimized for human cell expression, NP_044622 10 ug
$548.00
VC100809 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 1], codon optimized for human cell expression, NP_044623 10 ug
$844.00
VC100810 Myc-DDK-tagged ORF clone of viral ORF for thymidine kinase [Human herpesvirus 1], codon optimized for human cell expression, NP_044624 10 ug
$289.00 MSRP $503.00 MSRP $503.00
VC100811 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 1], codon optimized for human cell expression, NP_044625 10 ug
$330.00
VC100812 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 1], codon optimized for human cell expression, NP_044626 10 ug
$594.00
VC100814 Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044628 10 ug
$330.00
VC100815 Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044629 10 ug
$910.00
VC100816 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044630 10 ug
$791.00
VC100817 Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044631 10 ug
$589.00 MSRP $1,145.00 MSRP $1,145.00
VC100818 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044632. Note: ORF is codon optimized 10 ug
$589.00 MSRP $1,182.00 MSRP $1,182.00
VC100819 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044633 10 ug
$330.00
VC100820 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 1], codon optimized for human cell expression, NP_044634 10 ug
$610.00
VC100821 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 1], codon optimized for human cell expression, NP_044635 10 ug
$165.00
VC100822 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044636 10 ug
$330.00
VC100823 Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044637 10 ug
$165.00
VC100825 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 1], codon optimized for human cell expression, NP_044639 10 ug
$1,075.00
VC100826 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 1], codon optimized for human cell expression, NP_044640 10 ug
$503.00
VC100828 Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044642 10 ug
$503.00
VC100829 Myc-DDK-tagged ORF clone of viral ORF for tegument host shutoff protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044643 10 ug
$289.00 MSRP $457.00 MSRP $457.00
VC100830 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044644. Note: ORF is codon optimized 10 ug
$289.00 MSRP $457.00 MSRP $457.00
VC100832 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein C [Human herpesvirus 1], codon optimized for human cell expression, NP_044646 10 ug
$523.00
VC100833 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL45 [Human herpesvirus 1], codon optimized for human cell expression, NP_044647 10 ug
$330.00
VC100834 Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP11/12 [Human herpesvirus 1], codon optimized for human cell expression, NP_044648 10 ug
$723.00
VC100836 Myc-DDK-tagged ORF clone of viral ORF for transactivating tegument protein VP16 [Human herpesvirus 1], codon optimized for human cell expression, NP_044650 10 ug
$289.00 MSRP $457.00 MSRP $457.00
VC100837 Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP22 [Human herpesvirus 1], codon optimized for human cell expression, NP_044651 10 ug
$450.00
VC100838 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 1], codon optimized for human cell expression, NP_044652 10 ug
$165.00
VC100839 Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 1], codon optimized for human cell expression, NP_044653 10 ug
$503.00
VC100840 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 1], codon optimized for human cell expression, NP_044654 10 ug
$289.00 MSRP $300.00 MSRP $300.00
VC100841 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044655 10 ug
$589.00 MSRP $1,013.00 MSRP $1,013.00
VC100842 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein K [Human herpesvirus 1], codon optimized for human cell expression, NP_044656 10 ug
$503.00
VC100844 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL55 [Human herpesvirus 1], codon optimized for human cell expression, NP_044658 10 ug
$330.00
VC100845 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL56 [Human herpesvirus 1], codon optimized for human cell expression, NP_044659 10 ug
$330.00
VC100849 Myc-DDK-tagged ORF clone of viral ORF for regulatory protein ICP22 [Human herpesvirus 1], codon optimized for human cell expression, NP_044663 10 ug
$503.00
VC100850 Myc-DDK-tagged ORF clone of viral ORF for virion protein US2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044664 10 ug
$330.00
VC100851 Myc-DDK-tagged ORF clone of viral ORF for serine/threonine protein kinase US3 [Human herpesvirus 1], codon optimized for human cell expression, NP_044665 10 ug
$686.00
VC100852 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein G [Human herpesvirus 1], codon optimized for human cell expression, NP_044666 10 ug
$330.00
VC100853 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein J [Human herpesvirus 1], codon optimized for human cell expression, NP_044667 10 ug
$165.00
VC100854 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein D [Human herpesvirus 1], codon optimized for human cell expression, NP_044668 10 ug
$732.00
VC100855 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein I [Human herpesvirus 1], codon optimized for human cell expression, NP_044669 10 ug
$503.00
VC100856 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein E [Human herpesvirus 1], codon optimized for human cell expression, NP_044670 10 ug
$563.00
VC100858 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US9 [Human herpesvirus 1], codon optimized for human cell expression, NP_044672 10 ug
$165.00
VC100859 Myc-DDK-tagged ORF clone of viral ORF for virion protein US10 [Human herpesvirus 1], codon optimized for human cell expression, NP_044673 10 ug
$330.00
VC100861 Myc-DDK-tagged ORF clone of viral ORF for TAP transporter inhibitor ICP47 [Human herpesvirus 1], codon optimized for human cell expression, NP_044675 10 ug
$240.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.