IVa2 (AC_000007) Virus Tagged ORF Clone

SKU
VC100058
Myc-DDK-tagged ORF clone of viral ORF for IVa2 [Human adenovirus 2], codon optimized for human cell expression, AP_000165
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$503.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol IVa2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC100058 represents NCBI reference of AP_000165 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAACCAGAGGCCGCCGCCCAGCTGCACTGCAGCACCAACAGGATCAACCTCAGGCTCACCCCGGCC
AGAGAGCTGCGAGATCTGCACCACTGCACCGCGACCCAGATTATGCCGATGAGGACCCCGCCCCGGTCGA
GAGACACGATCCAGGCCCTTCCGGAAGAGCACCAACTACCGCGGTGCAGCGAAAGCCGCCACAACCCGCC
AAGCGCGGCGATATGTTGGACAGAGATGCAGTGGAGCACGTAACAGAACTTTGGGACAGGCTGGAGCTGC
TTGGCCAGACACTGAAATCAATGCCTACCGCTGATGGCCTCAAACCCCTTAAAAACTTCGCCTCCTTGCA
GGAGCTTCTCTCCCTCGGGGGCGAGCGGCTGCTGGCGCACCTGGTCAGGGAGAATATGCAGGTGCGCGAT
ATGCTCAACGAGGTCGCTCCACTGCTCAGAGACGATGGCAGTTGTAGTTCACTGAATTACCAACTCCAGC
CCGTCATCGGTGTGATCTATGGCCCCACTGGGTGCGGAAAGTCACAACTGCTTAGGAACCTGCTGTCTTC
ACAGCTGATTTCACCCACCCCGGAAACAGTCTTCTTTATCGCGCCTCAGGTCGACATGATACCGCCGTCT
GAACTGAAGGCTTGGGAGATGCAAATATGTGAGGGCAATTATGCACCTGGGCCTGATGGCACAATCATCC
CTCAGTCTGGGACCCTCCGGCCGCGGTTTGTCAAGATGGCCTACGATGACCTGATCCTTGAGCATAACTA
CGATGTCAGCGATCCTCGAAATATCTTTGCACAAGCAGCAGCCAGAGGCCCAATCGCGATTATCATGGAT
GAGTGCATGGAGAACCTGGGCGGACATAAAGGAGTTTCCAAATTTTTCCACGCTTTCCCTTCAAAGCTGC
ACGATAAATTTCCGAAGTGCACCGGATATACCGTACTGGTCGTACTCCATAATATGAACCCGCGGCGGGA
TATGGCCGGTAATATAGCTAATCTGAAAATTCAGTCCAAGATGCACCTGATCAGCCCCCGCATGCACCCT
TCACAGCTGAATAGGTTTGTGAACACCTATACAAAGGGCCTGCCCCTTGCCATCTCTTTGCTTCTCAAGG
ATATTTTCAGACATCATGCTCAGAGAAGTTGCTATGACTGGATCATTTACAACACTACTCCTCAACATGA
AGCCCTCCAGTGGTGCTACCTTCACCCACGCGATGGACTGATGCCAATGTACCTGAATATCCAGTCACAC
CTTTACCACGTGCTTGAGAAGATCCACAGGACGCTGAACGACAGAGATCGGTGGTCCAGAGCCTACCGGG
CTCGGAAGACTCCTAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC100058 representing AP_000165
Red=Cloning sites Green=Tags

METRGRRPAALQHQQDQPQAHPGQRAARSAPLHRDPDYADEDPAPVERHDPGPSGRAPTTAVQRKPPQPA
KRGDMLDRDAVEHVTELWDRLELLGQTLKSMPTADGLKPLKNFASLQELLSLGGERLLAHLVRENMQVRD
MLNEVAPLLRDDGSCSSLNYQLQPVIGVIYGPTGCGKSQLLRNLLSSQLISPTPETVFFIAPQVDMIPPS
ELKAWEMQICEGNYAPGPDGTIIPQSGTLRPRFVKMAYDDLILEHNYDVSDPRNIFAQAAARGPIAIIMD
ECMENLGGHKGVSKFFHAFPSKLHDKFPKCTGYTVLVVLHNMNPRRDMAGNIANLKIQSKMHLISPRMHP
SQLNRFVNTYTKGLPLAISLLLKDIFRHHAQRSCYDWIIYNTTPQHEALQWCYLHPRDGLMPMYLNIQSH
LYHVLEKIHRTLNDRDRWSRAYRARKTPK

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN AC_000007
ORF Size 1347 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq AC_000007.1, AP_000165
RefSeq ORF 1347 bp
UniProt ID P03254
MW 50.9 kDa
Write Your Own Review
You're reviewing:IVa2 (AC_000007) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC100037 Myc-DDK-tagged ORF clone of viral ORF for 52K [Human adenovirus 2], codon optimized for human cell expression, AP_000168 10 ug
$503.00
VC100038 Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus 2], codon optimized for human cell expression, AP_000169 10 ug
$599.00
VC100039 Myc-DDK-tagged ORF clone of viral ORF for III [Human adenovirus 2], codon optimized for human cell expression, AP_000170 10 ug
$585.00
VC100040 Myc-DDK-tagged ORF clone of viral ORF for pVII [Human adenovirus 2], codon optimized for human cell expression, AP_000171 10 ug
$330.00
VC100041 Myc-DDK-tagged ORF clone of viral ORF for V [Human adenovirus 2], codon optimized for human cell expression, AP_000172 10 ug
$503.00
VC100042 Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus 2], codon optimized for human cell expression, AP_000173 10 ug
$165.00
VC100043 Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus 2], codon optimized for human cell expression, AP_000174 10 ug
$330.00
VC100044 Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus 2], codon optimized for human cell expression, AP_000175 10 ug
$975.00
VC100045 Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus 2], codon optimized for human cell expression, AP_000176 10 ug
$330.00
VC100046 Myc-DDK-tagged ORF clone of viral ORF for DBP [Human adenovirus 2], codon optimized for human cell expression, AP_000177 10 ug
$542.00
VC100047 Myc-DDK-tagged ORF clone of viral ORF for 100K [Human adenovirus 2], codon optimized for human cell expression, AP_000178 10 ug
$811.00
VC100048 Myc-DDK-tagged ORF clone of viral ORF for 33K [Human adenovirus 2], codon optimized for human cell expression, AP_000179 10 ug
$330.00
VC100049 Myc-DDK-tagged ORF clone of viral ORF for 22K [Human adenovirus 2], codon optimized for human cell expression, AP_000180 10 ug
$330.00
VC100050 Myc-DDK-tagged ORF clone of viral ORF for pVIII [Human adenovirus 2], codon optimized for human cell expression, AP_000181 10 ug
$330.00
VC100051 Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus 2], codon optimized for human cell expression, AP_000190 10 ug
$596.00
VC100052 Myc-DDK-tagged ORF clone of viral ORF for U exon, partial [Human adenovirus 2], codon optimized for human cell expression, AP_000189 10 ug
$165.00
VC100053 Myc-DDK-tagged ORF clone of viral ORF for IX [Human adenovirus 2], codon optimized for human cell expression, AP_000164 10 ug
$165.00
VC100054 Myc-DDK-tagged ORF clone of viral ORF for E1A [Human adenovirus 2], codon optimized for human cell expression, AP_000161 10 ug
$330.00
VC100055 Myc-DDK-tagged ORF clone of viral ORF for E1B 19K [Human adenovirus 2], codon optimized for human cell expression, AP_000162 10 ug
$330.00
VC100056 Myc-DDK-tagged ORF clone of viral ORF for E1B 55K [Human adenovirus 2], codon optimized for human cell expression, AP_000163 10 ug
$503.00
VC100057 Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus 2], codon optimized for human cell expression, AP_000167 10 ug
$676.00
VC100060 Myc-DDK-tagged ORF clone of viral ORF for E3 125K [Human adenovirus 2], codon optimized for human cell expression, AP_000182 10 ug
$165.00
VC100061 Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-alphap0 [Human adenovirus 2], codon optimized for human cell expression, AP_000183 10 ug
$165.00
VC100062 Myc-DDK-tagged ORF clone of viral ORF for E3 gp19K [Human adenovirus 2], codon optimized for human cell expression, AP_000184 10 ug
$165.00
VC100063 Myc-DDK-tagged ORF clone of viral ORF for 116 kD protein [Human adenovirus 2], codon optimized for human cell expression, AP_000185 10 ug
$165.00
VC100064 Myc-DDK-tagged ORF clone of viral ORF for E3 RID alpha [Human adenovirus 2], codon optimized for human cell expression, AP_000186 10 ug
$289.00
VC100065 Myc-DDK-tagged ORF clone of viral ORF for E3 RID beta [Human adenovirus 2], codon optimized for human cell expression, AP_000187 10 ug
$165.00
VC100066 Myc-DDK-tagged ORF clone of viral ORF for E3 147K [Human adenovirus 2], codon optimized for human cell expression, AP_000188 10 ug
$165.00
VC100067 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF6/7 [Human adenovirus 2], codon optimized for human cell expression, AP_000191 10 ug
$165.00
VC100068 Myc-DDK-tagged ORF clone of viral ORF for E4 34K [Human adenovirus 2], codon optimized for human cell expression, AP_000192 10 ug
$330.00
VC100069 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF4 [Human adenovirus 2], codon optimized for human cell expression, AP_000193 10 ug
$289.00
VC100070 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF3 [Human adenovirus 2], codon optimized for human cell expression, AP_000194 10 ug
$165.00
VC100071 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF2 [Human adenovirus 2], codon optimized for human cell expression, AP_000195 10 ug
$165.00
VC100072 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF1 [Human adenovirus 2], codon optimized for human cell expression, AP_000196 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.