NICE2 (S100A7A) (NM_176823) Human Tagged ORF Clone

SKU
RG221177
S100A7A (tGFP-tagged) - Human S100 calcium binding protein A7A (S100A7A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NICE2
Synonyms NICE-2; NICE2; S100A7f; S100A7L1; S100A15
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG221177 representing NM_176823
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAACACTCAAGCTGAGAGGTCCATAATAGGCATGATCGACATGTTTCACAAATACACCGGACGTG
ATGGCAAGATTGAGAAGCCAAGCCTGCTGACGATGATGAAGGAGAACTTCCCCAATTTCCTCAGTGCCTG
TGACAAAAAGGGCATACATTACCTCGCCACTGTCTTTGAGAAAAAGGACAAGAATGAGGATAAGAAGATT
GATTTTTCTGAGTTTCTGTCCTTGCTGGGAGACATAGCCGCAGACTACCACAAGCAGAGCCATGGAGCGG
CGCCCTGTTCTGGGGGAAGCCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG221177 representing NM_176823
Red=Cloning site Green=Tags(s)

MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKI
DFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_176823
ORF Size 303 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_176823.4
RefSeq Size 4351 bp
RefSeq ORF 306 bp
Locus ID 338324
UniProt ID Q86SG5
Cytogenetics 1q21.3
Summary May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NICE2 (S100A7A) (NM_176823) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221177 S100A7A (Myc-DDK-tagged)-Human S100 calcium binding protein A7A (S100A7A) 10 ug
$150.00
RC221177L1 Lenti ORF clone of Human S100 calcium binding protein A7A (S100A7A), Myc-DDK-tagged 10 ug
$450.00
RC221177L2 Lenti ORF clone of Human S100 calcium binding protein A7A (S100A7A), mGFP tagged 10 ug
$450.00
RC221177L3 Lenti ORF clone of Human S100 calcium binding protein A7A (S100A7A), Myc-DDK-tagged 10 ug
$450.00
RC221177L4 Lenti ORF clone of Human S100 calcium binding protein A7A (S100A7A), mGFP tagged 10 ug
$450.00
SC307072 S100A7A (untagged)-Human S100 calcium binding protein A7A (S100A7A) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.