BD2 (DEFB4A) (NM_004942) Human Tagged ORF Clone

SKU
RG219487
DEFB4A (tGFP-tagged) - Human defensin, beta 4A (DEFB4A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BD2
Synonyms BD-2; DEFB-2; DEFB2; DEFB4; DEFB102; HBD-2; SAP1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG219487 representing NM_004942
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGTCTTGTATCTCCTCTTCTCGTTCCTCTTCATATTCCTGATGCCTCTTCCAGGTGTTTTTGGTG
GTATAGGCGATCCTGTTACCTGCCTTAAGAGTGGAGCCATATGTCATCCAGTCTTTTGCCCTAGAAGGTA
TAAACAAATTGGCACCTGTGGTCTCCCTGGAACAAAATGCTGCAAAAAGCCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG219487 representing NM_004942
Red=Cloning site Green=Tags(s)

MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004942
ORF Size 192 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004942.4
RefSeq Size 336 bp
RefSeq ORF 195 bp
Locus ID 1673
UniProt ID O15263
Cytogenetics 8p23.1
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Summary Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:BD2 (DEFB4A) (NM_004942) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219487 DEFB4A (Myc-DDK-tagged)-Human defensin, beta 4A (DEFB4A) 10 ug
$150.00
RC219487L1 Lenti ORF clone of Human defensin, beta 4A (DEFB4A), Myc-DDK-tagged 10 ug
$450.00
RC219487L2 Lenti ORF clone of Human defensin, beta 4A (DEFB4A), mGFP tagged 10 ug
$450.00
RC219487L3 Lenti ORF clone of Human defensin, beta 4A (DEFB4A), Myc-DDK-tagged 10 ug
$450.00
RC219487L4 Lenti ORF clone of Human defensin, beta 4A (DEFB4A), mGFP tagged 10 ug
$450.00
SC303551 DEFB4A (untagged)-Human defensin, beta 4A (DEFB4A) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.